One eye.
field ×74 · 0.97Every field.

36 solutions · 1 only here

Construction sites

Is this site safe right now, and is the build on schedule?

Built fromcustom detectorzonepersonruletrackertimermotionvehicleany-object (YOLOE)proximitycomparesegmentmeasureschedule

Build this for my site

1. Crane load swinging over the fence above the streetCrane load swung over a street or a crowd · custom detector → zone → alert
2. Tool or offcut dropped from the scaffoldSomething thrown or dropped from height · motion → tracker → speed → alert+ 1 other field
3. People on site nobody enrolled at induction, and how long they stayedPeople nobody enrolled, and how long they stayed · ReID → cross-camera → timer → report+ 1 other field
4. Lifts per hour for each tower craneMoves or lifts per hour for each crane · custom detector → tracker → counter → report+ 1 other field
5. Snags listed from a new flat’s handover walk-throughSnags listed from a handover walk-through · custom detector → snapshot → report+ 1 other field
6. Site turnstile that opens only for a helmet and hi-visDoor or turnstile that opens only when the kit is on · person + custom detector → rule → relay+ 2 other fields
7. Worker lifted in a loader bucketSomeone riding on forks, a bucket or a drawbar · person + custom detector → proximity → alert+ 2 other fields
8. Tower-crane jibs swinging into each other’s pathsCrane jibs or booms swinging into each other · custom detector → tracker → proximity → alert+ 2 other fields
9. Mobile crane lifting with an outrigger half outMobile crane lifting without its outriggers out on mats · custom detector → rule → alert+ 2 other fields
10. Tipper reversing on site with no banksmanReversing with no banksman guiding it · vehicle + person → direction → rule → alert+ 2 other fields
11. Gap in the site hoardingFence cut or dug under · custom detector → compare → alert+ 2 other fields
12. Diesel drained from the plant overnightFuel siphoned from a tank or generator · person + any-object (YOLOE) → zone → alert+ 2 other fields
13. Daily progress photo per floor from a fixed PTZ presetWork progress photographed and measured against the plan · drone video → segment → compare → report+ 2 other fields
14. Worker in a trench deeper than 1.2 m with no shoringTrench unsafe: no shoring, spoil at the edge, someone inside · person + custom detector → zone → rule → alert+ 3 other fields
15. The site’s weekend in one minute of footageA night of footage summed up in one minute · motion → tracker → clip+ 3 other fields
16. Muddy trucks leaving without passing the wheel washVehicle skipping a stop it must make: wash, check or scan · vehicle → zone → sequence → alert+ 3 other fields
17. Workers on the site stair tower not holding the railPeople on the stairs not holding the handrail · pose → zone → rule → report+ 4 other fields
18. Tools and cable thrown over the site hoardingGoods thrown over the fence to someone outside · motion → tracker → line → alert+ 4 other fields
19. Dumper driven without the seatbeltSeatbelt or helmet not worn while driving or riding · vehicle + custom detector → rule → snapshot+ 4 other fields
20. Standing on the top step of a stepladderLadder used unsafely: top step, over-reaching, unfooted · pose + custom detector → rule → alert+ 5 other fields
21. Crane or excavator boom reaching towards an overhead lineBoom or tipper raised near an overhead power line · custom detector → zone → measure → alert+ 5 other fields
22. Ladder left standing after the shift endsClutter left out: trays, trolleys, boxes, cables · any-object (YOLOE) → zone → timer → alert+ 5 other fields
23. Morning toolbox talk held, and who attendedSafety briefing held, and who attended · face ID → zone → schedule → report+ 5 other fields
24. Excavators, cranes and loaders on site, counted dailyStock counted where it stands, against the system · custom detector → zone → counter → report+ 5 other fields
25. Guard rail or floor-hole cover missing on the scaffold or slabSafety kit or cover missing from its place · any-object (YOLOE) → rule → alert+ 5 other fields
26. Dust plume drifting past the site fenceDust or smoke over the limit · segment → measure → alert+ 5 other fields
27. Gas bottles left standing loose on the siteGas cylinders standing without a chain or cage · custom detector → rule → alert+ 5 other fields
28. Dump truck reversing close to a worker, with closing speedNear miss between a person and a moving machine · person + any-object (YOLOE) → proximity → speed → alert+ 6 other fields
29. Roofers working through the midday heat with no breakToo long in the heat or the cold without a break · person → zone → schedule + timer → alert+ 6 other fields
30. Subcontractor headcount on site against what is billedHours on site by face: staff, contractors, trainers · face ID → attendance → report+ 6 other fields
31. Rebar spacing checked before the concrete pourSize and position measured against the drawing · segment → measure → compare → relay+ 7 other fields
32. Concrete mixers on site and the minutes each spent pouringEach vehicle’s time at each stop, and for how long · vehicle + COCO object → zone → timer → report+ 9 other fields
33. Plant left idling through the lunch breakEngines and equipment running when nobody needs them · motion + thermal camera → timer → alert+ 10 other fields
34. Crane-swing and excavation no-go areas, by hourPerson inside a hazard zone while it is live · person → zone → schedule → alert + relay+ 14 other fields
35. After-hours entry to the material yardIntrusion: someone inside the fence or a closed zone · person → zone → PTZ → alert+ 14 other fields
36. Helmet, hi-vis, and a harness above 2 mProtective kit worn where the job needs it · person + custom detector → zone → alert+ 20 other fields

Show all 36

47 solutions · 2 only here

Warehousing & logistics

Is anybody walking where the forklifts drive?

Built fromcustom detectorzonepersonrulemeasurevehiclecomparetrackerposetimerschedulecounterspeedOCR

Build this for my site

1. Forklift driving with its forks raisedcustom detector → speed → rule → alert
2. Trailer creeping away from the dock during loadingvehicle → tracker → measure → relay
3. Trailer seal number read and checked at the gateSeal intact on every door and cover · custom detector + OCR → compare → alert+ 1 other field
4. Forklift starts only for a trained driverOnly the assigned driver can start the vehicle · face ID → compare → relay+ 1 other field
5. Walking distance per pick list, aisle by aisleWalking distance per order on the picker’s route · person → tracker → measure → report+ 1 other field
6. Trailer loaded to capacity before it leaves the dockTruck or trailer loaded to the right level · segment → measure → report+ 1 other field
7. Pallet dimensions measured at the dock for billingParcel and pallet dimensions measured for billing · segment → measure → webhook+ 1 other field
8. Heavy cartons stacked on fragile ones on a palletHeavy goods stacked on fragile ones · custom detector → classify → rule → alert+ 1 other field
9. Reefer trailer unplugged in the yardReefer container or trailer left unplugged · custom detector → rule → alert+ 1 other field
10. Heavy boxes lifted with a bent backAwkward lifting and bending, scored for strain · pose → measure → report+ 2 other fields
11. Pallets above the height limit or overhanging the beamStacked too high or overhanging the edge · custom detector → measure → alert+ 2 other fields
12. Picker riding on the forks or on a raised palletSomeone riding on forks, a bucket or a drawbar · person + custom detector → proximity → alert+ 2 other fields
13. Dock light kept red until the trailer’s wheels are chockedWheel chocks in before loading starts · custom detector → rule → relay+ 2 other fields
14. Truck reversing onto a dock with no banksman in the yardReversing with no banksman guiding it · vehicle + person → direction → rule → alert+ 2 other fields
15. Fuel siphoned from trucks parked in the yardFuel siphoned from a tank or generator · person + any-object (YOLOE) → zone → alert+ 2 other fields
16. Trailer doors opened in the yard at nightTrailer or container doors opened in the yard · classify + person → schedule → alert+ 2 other fields
17. Kingpin not locked, or landing legs down, as the tractor pulls awayTrailer coupled right before it pulls away · custom detector → classify → alert+ 2 other fields
18. Truck guided back square onto the dock, the gap shownVehicle guided onto its stop mark · vehicle → tracker → measure → webhook+ 2 other fields
19. Pallets and roll cages counted out and back with each carrierReturnable cages, crates and batteries counted out and back · custom detector → counter → compare → report+ 2 other fields
20. Truck leaving the yard without a gate passGoods or cars leaving without a dispatch order · custom detector + plate OCR → line → compare → alert+ 2 other fields
21. Each pallet followed from the dock to its rackEach pallet or parcel followed from the dock to its place · custom detector + barcode → cross-camera → webhook+ 2 other fields
22. Forklift driver on the phone while drivingPhone in hand where it is not allowed · pose + COCO object → phone use → review+ 3 other fields
23. Chilled pallets left on the dock too longChilled goods left out of the cold too long · custom detector → zone → timer → alert+ 3 other fields
24. Pallet put away in the wrong rack locationStock put away in the wrong place · barcode + custom detector → zone → compare → alert+ 3 other fields
25. Boxes thrown over the yard fence to a waiting carGoods thrown over the fence to someone outside · motion → tracker → line → alert+ 4 other fields
26. Forklift over 10 km/h in the aislesVehicle over the speed limit for the place · vehicle → tracker → speed → snapshot+ 4 other fields
27. Forklift driven without the seatbeltSeatbelt or helmet not worn while driving or riding · vehicle + custom detector → rule → snapshot+ 4 other fields
28. Pallets picked out of date orderNewest stock picked before the oldest · OCR → sequence → review+ 4 other fields
29. Picker climbing the racking instead of using a ladderClimbing, standing or sitting where it is not allowed · pose → zone → rule → alert+ 5 other fields
30. Picker over-reaching sideways from a ladderLadder used unsafely: top step, over-reaching, unfooted · pose + custom detector → rule → alert+ 5 other fields
31. Tipper body raised in the yard under a power lineBoom or tipper raised near an overhead power line · custom detector → zone → measure → alert+ 5 other fields
32. Shift huddle held on the warehouse floorSafety briefing held, and who attended · face ID → zone → schedule → report+ 5 other fields
33. Pallets counted in the racksStock counted where it stands, against the system · custom detector → zone → counter → report+ 5 other fields
34. Forklift within 2 m of a walkerNear miss between a person and a moving machine · person + any-object (YOLOE) → proximity → speed → alert+ 6 other fields
35. Dock doors in use, hour by hourHow much each room, bay or machine is really used · person + vehicle → zone → counter → report+ 6 other fields
36. Pallets loaded onto each truck against the delivery noteGoods counted onto or off each vehicle · custom detector → line → counter → report+ 6 other fields
37. Forklift driving into the canteen walkwayVehicles, carts or scooters in a space kept for people · any-object (YOLOE) → zone → schedule → alert+ 7 other fields
38. Dock door left open after the truck has goneDoor held open or forced · door event + person → timer → alert+ 7 other fields
39. Pallet labels read by a drone flying the aislesUnit numbers read and logged: containers, wagons, VINs, serials · custom detector → OCR → webhook+ 8 other fields
40. Racking upright bent, or a broken pallet in the rackBroken fittings found: glass, seats, nets, racking · custom detector → compare → report+ 8 other fields
41. Trucks at the gate and at each dock, and for how longEach vehicle’s time at each stop, and for how long · vehicle + COCO object → zone → timer → report+ 9 other fields
42. Trucks idling in the yard while they wait for a dockEngines and equipment running when nobody needs them · motion + thermal camera → timer → alert+ 10 other fields
43. Forklift pre-use check walked round before the shiftSteps of a procedure done, and in the right order · pose → zone → sequence → alert+ 11 other fields
44. Pallet left in the fire-exit lane for over 10 minSomething blocking a way or kit that must stay clear · tile → custom detector → zone → timer → alert+ 12 other fields
45. Flame or smoke under the roof, before the detectors tripFlame or smoke spotted early, indoors or on the horizon · custom detector + thermal camera → PTZ → alert+ 12 other fields
46. Pedestrian stepping off the painted walkwayPerson inside a hazard zone while it is live · person → zone → schedule → alert + relay+ 14 other fields
47. Hi-vis on everyone walking the warehouse floorProtective kit worn where the job needs it · person + custom detector → zone → alert+ 20 other fields

Show all 47

38 solutions · 3 only here

Retail & shop chains

Which of my shops needs attention today?

Built fromcustom detectorpersonzonerulecounterposecomparetimertrackerlineOCRsensorsales CSVheatmap

Build this for my site

1. Items counted into the fitting room and out againcustom detector → counter → compare → alert
2. Security tag left on a sold item at the tillSecurity tag left on a sold item · custom detector → rule → alert
3. Products picked up and put back, shelf by shelfpose + custom detector → zone → counter → report
4. Showcase left unlocked with no assistant beside itShowcase left unlocked with nobody beside it · classify + person → rule → alert+ 1 other field
5. Goods slipped into a bag, or a shelf swept cleanGoods slipped into a bag or pocket · pose + tracker → rule → review+ 1 other field
6. Visitors who reach the tillVisitors who become buyers · person → line → zone → report+ 1 other field
7. Anonymous sex and age bandsperson → demographics → report+ 1 other field
8. Till sales beside the cameras (CSV)Till sales beside the cameras · sales CSV + counter → report+ 1 other field
9. Shelf layout checked against the planogramShelf set out as the plan says, and the brand’s share of it · custom detector → compare → report+ 1 other field
10. Shelf price tag that differs from the till pricePrice shown that differs from the price charged · OCR + sales CSV → compare → alert+ 1 other field
11. Chilled goods past their date still on the shelfGoods past their date still on the shelf · OCR → rule → report+ 1 other field
12. Stock overhanging the top shelfStacked too high or overhanging the edge · custom detector → measure → alert+ 2 other fields
13. Hammer blows on a showcase: smash-and-grabSmash-and-grab or a machine being forced open · custom detector + pose → rule → alert+ 2 other fields
14. Dwell time and a floor heatmap in metresWhere people stop, and for how long · person → tracker → heatmap → report+ 2 other fields
15. Shoppers who left the queue without buyingPeople who gave up and left before being served · sensor + ReID → rule → report+ 2 other fields
16. HQ view ranking shops worst-firstEvery site ranked for head office, day, week and month · counter + review → report+ 2 other fields
17. Cashier held up at the tillDuress: hands raised in a hold-up · pose → hands raised → alert+ 3 other fields
18. The stockroom’s day in one minute of everything that movedA night of footage summed up in one minute · motion → tracker → clip+ 3 other fields
19. Frozen delivery left standing on the shop floorChilled goods left out of the cold too long · custom detector → zone → timer → alert+ 3 other fields
20. Items left on the wrong shelfStock put away in the wrong place · barcode + custom detector → zone → compare → alert+ 3 other fields
21. Someone who isn’t staff in the stockroomSomeone who isn’t staff in a staff-only area · face ID → post → alert+ 4 other fields
22. Item passed over the self-checkout scanner without a beepTill exceptions: no scan, no sale, cash off the books · pose + sensor → compare → review+ 4 other fields
23. Click-and-collect customers kept waiting at the deskMinutes to serve each customer · person + vehicle → zone → timer → report+ 4 other fields
24. Staff on the floor against the shoppers in, hour by hourStaff on the floor against the customers in · face ID + person → counter → compare → report+ 4 other fields
25. Fresh stock put in front of older stock on the shelfNewest stock picked before the oldest · OCR → sequence → review+ 4 other fields
26. Spilled liquid in an aisleSpill or puddle where people walk · segment + YOLO-World → rule → alert+ 4 other fields
27. Staff on a stockroom ladder with nobody footing itLadder used unsafely: top step, over-reaching, unfooted · pose + custom detector → rule → alert+ 5 other fields
28. Customers stumbling at the same step by the entranceTrips and stumbles counted by place, before someone falls · pose → tracker → heatmap → report+ 6 other fields
29. Store deliveries counted in against the delivery noteGoods counted onto or off each vehicle · custom detector → line → counter → report+ 6 other fields
30. Customer slipped and down in an aisleFall or collapse: someone down and not getting up · pose → person down → alert + relay+ 7 other fields
31. Jewellery trays out of the case, counted back at closingValuable or equipment taken from its place · person + custom detector → zone → rule → alert+ 7 other fields
32. Footfall in and out, by hourFootfall: people in and out, by hour · person → line → counter → report+ 7 other fields
33. Customer waiting at the self-checkout help lightCall for help or an alarm, and how long until someone comes · person + sensor → zone → timer → alert+ 8 other fields
34. Fitting rooms full while shoppers wait outsideHow full it is right now, against capacity · person → zone → counter → webhook+ 9 other fields
35. Till left unstaffed while customers waitPost manned: a work position empty too long · person → post → timer → alert+ 9 other fields
36. Empty shelf facings, sent to the stockroomRunning empty: shelf, bin, tray or feeder to refill · custom detector → zone → rule → alert+ 9 other fields
37. Stock cages left in front of a fire exitSomething blocking a way or kit that must stay clear · tile → custom detector → zone → timer → alert+ 12 other fields
38. Queue at the tills, with a call to open anotherQueue length and wait, with a call to open another point · person + vehicle → zone → counter + timer → alert+ 15 other fields

Show all 38

26 solutions · 6 only here

Security & guarded sites

Who passed, when, and what happened?

Built frompersonzonetimerrulemotioncompareposetrackerclassifycolourReIDstream healthscheduleface ID

Build this for my site

1. Search people by description and timeperson → colour → ReID → report
2. Every claim traced back to the frame, as a zipReID → cross-camera → snapshot → report
3. An alerts centre with a verdict on every alertalert → review → report
4. A camera wall with Telegram switchesstream health → schedule → alert
5. Doors, relays and PTZ presets on a ruleperson → zone → relay + PTZ
6. The cameras’ own line and intrusion events, no GPU neededcamera analytics → rule → alert
7. Loitering by a gate or fence for over 5 minLoitering: someone hanging about for no reason · person → zone → timer → alert+ 1 other field
8. Watchlist alerts on any camera: people the site has barredBarred people spotted on any camera · face ID → watchlist → alert+ 1 other field
9. Which camera is down, and since whenCamera down or a view uncovered, and since when · stream health → timer → alert+ 1 other field
10. Camera tamper: covered, moved, defocusedCamera covered, moved or out of focus · motion → compare → alert+ 1 other field
11. People blurred in every clip and evidence framePeople blurred before a frame leaves the box · person → blur → clip+ 1 other field
12. Knife or gun drawn in viewany-object (YOLOE) + pose → rule → alert+ 1 other field
13. Guard asleep at the gatehouse deskAsleep on duty · pose → posture → timer → review+ 1 other field
14. Hole cut in the fence or dug beneath itFence cut or dug under · custom detector → compare → alert+ 2 other fields
15. Guard patrol walked on time, checkpoint by checkpointRounds walked on time, checkpoint by checkpoint · face ID → zone → sequence → report+ 2 other fields
16. Fights and violenceFight or violence breaking out · pose → tracker → rule → alert+ 3 other fields
17. A whole night of the perimeter in a one-minute clipA night of footage summed up in one minute · motion → tracker → clip+ 3 other fields
18. Movement at 3 am where there is never anySomething unusual for this camera at this hour · motion + tracker → trend → alert+ 3 other fields
19. Suspicious items flagged in the mailroom X-rayX-ray image checked for hidden or dangerous goods · custom detector → classify → review+ 4 other fields
20. Vehicle ramming the perimeter gateVehicle forcing its way through a barrier or gate · vehicle → speed → line → alert+ 5 other fields
21. Car at the gate on a plate registered to another modelPlate that does not match the car: cloned or swapped · plate OCR + classify + colour → compare → alert+ 5 other fields
22. Vehicle parked against the perimeter at nightVehicle stopped too long where time is limited · vehicle → zone → timer → alert+ 8 other fields
23. Guard on the spot after an alarm, in minutesCall for help or an alarm, and how long until someone comes · person + sensor → zone → timer → alert+ 8 other fields
24. Guard at the gatehouse through the whole shiftPost manned: a work position empty too long · person → post → timer → alert+ 9 other fields
25. Perimeter floodlights out at nightLights, screens and signs dark when they should be on · classify → schedule → report+ 9 other fields
26. Intrusion over the fence line or into zones drawn in metresIntrusion: someone inside the fence or a closed zone · person → zone → PTZ → alert+ 14 other fields

Show all 26

24 solutions · 1 only here

Restaurants & cafés

Was every post open on time, and was every guest served?

Built frompersontimercustom detectorzonecountercomparesensortableCOCO objectcolourrulesequenceface IDpost

Build this for my site

1. Guests greeted at the table within 2 minutesGuests greeted at the table in time · person → table → timer → alert
2. Covers and till sales per hour beside the camerasTill sales beside the cameras · sales CSV + counter → report+ 1 other field
3. Tables cleared in time: cups, plates, foodCOCO object → table → timer → alert+ 1 other field
4. Plates waiting at the pass for over 3 minWork waiting between two steps: a bottleneck forming · custom detector → zone → timer → alert+ 1 other field
5. Fryer oil too dark to use againFrying oil too dark to use again · colour → trend → alert+ 1 other field
6. Colour-coded boards used for the right foodColour-coded boards, cloths and tools used where they belong · colour + custom detector → rule → alert+ 2 other fields
7. Portion on every plate against the recipe cardPortion size on every plate or pack · segment → measure → compare → review+ 2 other fields
8. Dish plated like the reference photo before it leaves the passMade as the approved sample: print, stitching, plating · custom detector → compare → review+ 3 other fields
9. Kitchen burners left on after the last orderHeater, burner or iron left on after closing · custom detector → schedule → alert+ 3 other fields
10. Hands washed before platingHands washed or boots dipped before going in · person → zone → sequence → alert+ 4 other fields
11. Someone who isn’t staff behind the bar or tillSomeone who isn’t staff in a staff-only area · face ID → post → alert+ 4 other fields
12. Till drawer opened with no sale rung upTill exceptions: no scan, no sale, cash off the books · pose + sensor → compare → review+ 4 other fields
13. Drive-through cars and delivery riders: minutes to hand-overMinutes to serve each customer · person + vehicle → zone → timer → report+ 4 other fields
14. Waiting staff on the floor against the covers seatedStaff on the floor against the customers in · face ID + person → counter → compare → report+ 4 other fields
15. Plate waste logged by dish as the plates come backFood thrown away, logged by dish · custom detector + sensor → classify → report+ 4 other fields
16. Staff eating behind the counter in view of guestsThings brought where they are not allowed · any-object (YOLOE) → zone → alert+ 5 other fields
17. Gas bottles standing loose behind the kitchenGas cylinders standing without a chain or cage · custom detector → rule → alert+ 5 other fields
18. Table turnover: sitting length and time to resetTurnaround: time from one use to the next · person + COCO object → zone → timer → report+ 6 other fields
19. Supplier deliveries counted against the orderGoods counted onto or off each vehicle · custom detector → line → counter → report+ 6 other fields
20. Guest raising a hand, answered within a minuteCall for help or an alarm, and how long until someone comes · person + sensor → zone → timer → alert+ 8 other fields
21. Posts opened and closed on timePost manned: a work position empty too long · person → post → timer → alert+ 9 other fields
22. Every dish on the ticket at the pass before it goesEverything there: right parts, right count · custom detector → counter → compare → relay+ 10 other fields
23. Menu handed over, waiter back for the order in timeSteps of a procedure done, and in the right order · pose → zone → sequence → alert+ 11 other fields
24. Guests waiting at the door for a tableQueue length and wait, with a call to open another point · person + vehicle → zone → counter + timer → alert+ 15 other fields

Show all 24

20 solutions · 3 only here

Banks, ATMs & cash centres

What is happening in each branch, at each ATM and in the cash room?

Built fromzonepersontimerrulecounterposecustom detectorface IDany-object (YOLOE)comparepostvehicleproximityCOCO object

Build this for my site

1. Second person within 1 m of a customer at the ATMStranger too close to someone using a cash machine · person → proximity → zone → alert
2. Hands below the table in the counting roomHands out of sight in a cash-counting room · pose → zone → timer → review
3. Cash box carried off the marked handover pathCash carried off the marked handover path · custom detector → zone → alert
4. Someone lingering by the ATM for over 5 minLoitering: someone hanging about for no reason · person → zone → timer → alert+ 1 other field
5. Weapon drawn at a teller windowKnife or gun drawn in view · any-object (YOLOE) + pose → rule → alert+ 1 other field
6. Customer files left out on desks after closingLaptops and papers left out after hours · COCO object → schedule → report+ 1 other field
7. ATM screen showing out of serviceSelf-service machine showing an error · OCR → rule → webhook+ 1 other field
8. Both doors of the security vestibule open at onceBoth doors of an airlock or mantrap open at once · door event → rule → alert+ 2 other fields
9. ATM attacked: prised, cut or rammedSmash-and-grab or a machine being forced open · custom detector + pose → rule → alert+ 2 other fields
10. Skimmer fitted to an ATMSkimmer fitted to a card reader · custom detector → compare → alert+ 2 other fields
11. Key cabinet opened, and by whomLocked cabinet opened, and by whom · classify + face ID → snapshot → report+ 2 other fields
12. Every branch ranked on one screen, worst firstEvery site ranked for head office, day, week and month · counter + review → report+ 2 other fields
13. Duress: both hands raised at a windowDuress: hands raised in a hold-up · pose → hands raised → alert+ 3 other fields
14. Cash-room two-person ruleNobody alone where a second person is required · person → post + counter → rule → alert+ 4 other fields
15. Someone who isn’t staff behind the counterSomeone who isn’t staff in a staff-only area · face ID → post → alert+ 4 other fields
16. Tellers at windows against the customers waitingStaff on the floor against the customers in · face ID + person → counter → compare → report+ 4 other fields
17. Cash left in the ATM tray after the customer walks awayObject left behind by its owner · any-object (YOLOE) → timer → cross-camera → alert+ 6 other fields
18. Cash bags counted from the van into the vaultGoods counted onto or off each vehicle · custom detector → line → counter → report+ 6 other fields
19. Cash-in-transit van at the kerb past its slotVehicle stopped too long where time is limited · vehicle → zone → timer → alert+ 8 other fields
20. Queue at the teller windows, with a call to open anotherQueue length and wait, with a call to open another point · person + vehicle → zone → counter + timer → alert+ 15 other fields

Show all 20

31 solutions · 2 only here

Airports & terminals

Is anything left behind, and is every passenger and bag moving?

Built frompersonvehiclezonecustom detectortimertrackerrulecounterposespeedlinesensortileclassify

Build this for my site

1. Vehicle or aircraft over a runway hold line without clearancevehicle + custom detector → line → alert
2. First and last bag on the carousel, per flightCOCO object + sensor → timer → report
3. Drone near the runway approachDrone flying where it should not · tile → custom detector → PTZ → alert+ 1 other field
4. Taxi rank empty while passengers wait at the kerbPeople waiting and no transport: send more · person + vehicle → zone → rule → alert+ 1 other field
5. Terminal toilets cleaned after every 100 visitorsCleaning called by use, not by the clock · person → line → counter → alert+ 1 other field
6. Bags thrown onto the baggage belt by handlersGoods thrown instead of placed · pose + custom detector → speed → review+ 1 other field
7. Birds on the runwayBirds heading into aircraft or turbine blades · tile → animal → proximity → relay+ 1 other field
8. Aircraft chocked before the ground crew approachWheel chocks in before loading starts · custom detector → rule → relay+ 2 other fields
9. Aircraft guided onto the stand’s stop lineVehicle guided onto its stop mark · vehicle → tracker → measure → webhook+ 2 other fields
10. Someone walking back up the one-way arrivals corridorGoing the wrong way through a one-way point · vehicle + person → direction → alert+ 3 other fields
11. Queue barrier moved aside at the security lanesCrowd barrier pushed over, climbed or opened · person + custom detector → zone → rule → alert+ 4 other fields
12. Knives, batteries and liquids flagged in bag X-raysX-ray image checked for hidden or dangerous goods · custom detector → classify → review+ 4 other fields
13. Apron vehicles over the limit near aircraftVehicle over the speed limit for the place · vehicle → tracker → speed → snapshot+ 4 other fields
14. Bag fallen off a baggage cart on the apronLoad unsecured, or fallen off on the way · vehicle + custom detector → rule → alert+ 4 other fields
15. Cars backing up along the terminal kerbCongestion building: speeds dropping, queues growing · vehicle → tracker → speed → alert+ 4 other fields
16. Adverts on the terminal screens logged as playedAd screens showing the booked content, logged · classify → schedule → report+ 4 other fields
17. Luggage trolleys piling up at the exitsClutter left out: trays, trolleys, boxes, cables · any-object (YOLOE) → zone → timer → alert+ 5 other fields
18. Fire extinguisher missing from its bracketSafety kit or cover missing from its place · any-object (YOLOE) → rule → alert+ 5 other fields
19. Visibility on the apron in fog, loggedVisibility in fog or dust, measured from the camera · classify → measure → alert+ 5 other fields
20. Passengers suddenly running from one spot in the terminalCrowd suddenly running: many people fleeing at once · person → tracker → speed → alert+ 6 other fields
21. Terminal floors emptying, exit by exit, during an evacuationEvacuation watched live: exits used, floors cleared · person → line → counter → report+ 6 other fields
22. Passengers tripping at the ends of the travelatorsTrips and stumbles counted by place, before someone falls · pose → tracker → heatmap → report+ 6 other fields
23. Bag left alone for over 3 min, and who left itObject left behind by its owner · any-object (YOLOE) → timer → cross-camera → alert+ 6 other fields
24. Aircraft time on standTurnaround: time from one use to the next · person + COCO object → zone → timer → report+ 6 other fields
25. Passengers through the boarding gate against the manifestHeadcount against tickets and transactions · person + vehicle + sensor → counter → compare → review+ 7 other fields
26. Bag snatched from a trolley in the arrivals hallTheft from a person: pickpocket or bag snatch · pose + tracker → proximity → review+ 7 other fields
27. Wheelchair passenger waiting with no agent for 10 minCall for help or an alarm, and how long until someone comes · person + sensor → zone → timer → alert+ 8 other fields
28. Turnaround on stand: fuel, catering and steps on timeSteps of a procedure done, and in the right order · pose → zone → sequence → alert+ 11 other fields
29. Debris on the runway or taxiwaySomething blocking a way or kit that must stay clear · tile → custom detector → zone → timer → alert+ 12 other fields
30. Ground crew inside a running engine’s danger zonePerson inside a hazard zone while it is live · person → zone → schedule → alert + relay+ 14 other fields
31. Wait at the security lanes, shown on screensQueue length and wait, with a call to open another point · person + vehicle → zone → counter + timer → alert+ 15 other fields

Show all 31

46 solutions · 4 only here

Hospitals, clinics & pharmacies

Is anybody down, and is every patient and medicine where it should be?

Built fromzonepersonposetimercustom detectorrulecountercompareOCRvehiclebarcodeCOCO objectany-object (YOLOE)posture

Build this for my site

1. ICU patient pulling at a drip line or a breathing tubePatient pulling at a drip line or a tube · pose → rule → alert
2. Sterile field in theatre touched by someone not scrubbedSterile field touched by a hand that is not scrubbed · pose → zone → review
3. Patient on a trolley in the corridor for over 4 hoursPatient left on a trolley in a corridor for hours · person + custom detector → zone → timer → alert
4. Prescription-only medicine handed over without a scanMedicine handed over without its scan · pose + barcode → compare → review
5. Patient leaving the bedPatient getting out of bed alone · pose → posture → schedule → alert+ 1 other field
6. ICU patient not repositioned for 2 hoursBed-bound patient not turned in time · pose → posture → timer → alert+ 1 other field
7. Patient in the bathroom for over 20 minToo long in the bathroom · person → zone → timer → alert+ 1 other field
8. Patient meal trays returned untouchedMeals and drinks actually taken · pose + COCO object → counter → report+ 1 other field
9. Rough handling during a patient transferRough handling of a person in care · pose → speed → review+ 1 other field
10. Walking frame left out of the patient’s reachWalking aid left out of reach · YOLO-World + person → proximity → alert+ 1 other field
11. Patients sent back and forth between departmentsPeople sent back and forth between counters · ReID → cross-camera → counter → report+ 1 other field
12. Swabs and instruments counted in and out of surgeryRag, tool or swab left inside after the job · custom detector → compare → alert+ 1 other field
13. Medicines past their expiry date still on the shelfGoods past their date still on the shelf · OCR → rule → report+ 1 other field
14. Clean and dirty trolleys, or look-alike medicines, side by sideThings that must be kept apart, stored together · OCR + custom detector → proximity → alert+ 1 other field
15. Patient walking out of the dementia ward at nightSomeone leaving the grounds when they should stay · person → zone → schedule → alert+ 2 other fields
16. Theatre door opened during surgery, countedDoor openings counted where every opening costs · door event → counter → report+ 2 other fields
17. Controlled-drug cabinet opened, and by whomLocked cabinet opened, and by whom · classify + face ID → snapshot → report+ 2 other fields
18. Patients who left the emergency department before being seenPeople who gave up and left before being served · sensor + ReID → rule → report+ 2 other fields
19. Physio exercises scored at the bedsideMovement form scored: technique and injury risk · pose → measure → review+ 2 other fields
20. Staff attacked in the emergency departmentFight or violence breaking out · pose → tracker → rule → alert+ 3 other fields
21. Medicine put back in the wrong drawerStock put away in the wrong place · barcode + custom detector → zone → compare → alert+ 3 other fields
22. Hand hygiene at the sink before entering a wardHands washed or boots dipped before going in · person → zone → sequence → alert+ 4 other fields
23. Controlled drugs checked out by one nurse, not twoNobody alone where a second person is required · person → post + counter → rule → alert+ 4 other fields
24. Nurses on the ward against the patients in bedsStaff on the floor against the customers in · face ID + person → counter → compare → report+ 4 other fields
25. Newest medicine boxes picked ahead of older onesNewest stock picked before the oldest · OCR → sequence → review+ 4 other fields
26. Damp patches spreading in a wardDamp and mould spreading on walls and ceilings · segment → trend → report+ 4 other fields
27. Metal trolleys or cylinders wheeled towards the MRIThings brought where they are not allowed · any-object (YOLOE) → zone → alert+ 5 other fields
28. Defibrillator missing from its cabinetSafety kit or cover missing from its place · any-object (YOLOE) → rule → alert+ 5 other fields
29. Smoking under the hospital entrance canopySmoking where a spark is dangerous · any-object (YOLOE) → zone → alert+ 5 other fields
30. Oxygen cylinders standing loose in a corridorGas cylinders standing without a chain or cage · custom detector → rule → alert+ 5 other fields
31. Patients stumbling in the same corridor, week by weekTrips and stumbles counted by place, before someone falls · pose → tracker → heatmap → report+ 6 other fields
32. Beds occupied, ward by wardHow much each room, bay or machine is really used · person + vehicle → zone → counter → report+ 6 other fields
33. Operating-theatre turnaround between two surgeriesTurnaround: time from one use to the next · person + COCO object → zone → timer → report+ 6 other fields
34. Falls and collapses in wards and corridorsFall or collapse: someone down and not getting up · pose → person down → alert + relay+ 7 other fields
35. Fire door wedged open on a wardDoor held open or forced · door event + person → timer → alert+ 7 other fields
36. Ambulance bay blocked by a private carVehicle stopped too long where time is limited · vehicle → zone → timer → alert+ 8 other fields
37. Patient’s call light unanswered for 5 minCall for help or an alarm, and how long until someone comes · person + sensor → zone → timer → alert+ 8 other fields
38. Ambulances queuing at the emergency department, and for how longEach vehicle’s time at each stop, and for how long · vehicle + COCO object → zone → timer → report+ 9 other fields
39. Pharmacist at the counter throughout opening hoursPost manned: a work position empty too long · person → post → timer → alert+ 9 other fields
40. No wheelchairs left at the main entranceRunning empty: shelf, bin, tray or feeder to refill · custom detector → zone → rule → alert+ 9 other fields
41. Sharps bin past its line, or a drip bag nearly emptyBin, tank or bag nearly full or nearly empty · segment → measure → alert+ 9 other fields
42. Tablets counted into the pack at the pharmacy counterEverything there: right parts, right count · custom detector → counter → compare → relay+ 10 other fields
43. Blood tube labels matched to the request formLabel and code present, straight and right · OCR + barcode → compare → relay+ 11 other fields
44. Beds parked in front of a fire exitSomething blocking a way or kit that must stay clear · tile → custom detector → zone → timer → alert+ 12 other fields
45. Minutes each patient waits for triage in the emergency departmentQueue length and wait, with a call to open another point · person + vehicle → zone → counter + timer → alert+ 15 other fields
46. Mask and gown on before entering an isolation roomProtective kit worn where the job needs it · person + custom detector → zone → alert+ 20 other fields

Show all 46

13 solutions

Offices & business centres

Who is in the building, did one badge let in two, and which rooms are really used?

Built fromzonetimerpersonvehiclecounterscheduleruleReIDcross-camerabarcodeface IDCOCO objectclassifysensor

Build this for my site

1. Visitors nobody knows, and how long they stayedPeople nobody enrolled, and how long they stayed · ReID → cross-camera → timer → report+ 1 other field
2. Visitor pre-registered by QR, let in at the turnstileVisitor pass by QR that expires when the visit ends · barcode → face ID → schedule → relay+ 1 other field
3. Laptops left out on desks overnightLaptops and papers left out after hours · COCO object → schedule → report+ 1 other field
4. Air conditioning running with the windows openWindow or vent open against the heating, cooling or climate plan · classify + sensor → rule → alert+ 2 other fields
5. Staff car-park spaces free, shown at the gateFree parking bays counted and shown · vehicle → zone → counter → webhook+ 3 other fields
6. Room or hot desk booked but empty after 30 min, releasedBooked or reserved, and nobody there · any-object (YOLOE) → zone → timer → webhook+ 3 other fields
7. Staff on the stairs not holding the handrailPeople on the stairs not holding the handrail · pose → zone → rule → report+ 4 other fields
8. Tailgating: one badge, two bodiesTwo people through on one badge or ticket · turnstile + person → reconcile → alert+ 4 other fields
9. Visitors kept waiting at reception, in minutesMinutes to serve each customer · person + vehicle → zone → timer → report+ 4 other fields
10. Meeting rooms used by the hour, by how many, and overrunsHow much each room, bay or machine is really used · person + vehicle → zone → counter → report+ 6 other fields
11. Water stain spreading across a ceiling tileLeak from a pipe, roof, tank or drum · segment → trend → alert+ 7 other fields
12. Room occupancy against capacityHow full it is right now, against capacity · person → zone → counter → webhook+ 9 other fields
13. Lights and screens left on in empty rooms at nightEngines and equipment running when nobody needs them · motion + thermal camera → timer → alert+ 10 other fields

24 solutions · 4 only here

Schools, universities & exams

Who is on the grounds, is every pupil safe, and is the exam fair?

Built frompersonzoneschedulecountertimercompareposecustom detectorturnstileruleCOCO objectsensorany-object (YOLOE)vehicle

Build this for my site

1. Pickup pass shown at the gate doesn’t match the pupil’s listPupil collected without a matching pickup pass · barcode → compare → alert
2. Candidate still writing after time is calledStill writing after time is called · pose → schedule → review
3. Student-hall entry after curfew, from badge tapsEntry after curfew · turnstile → schedule → report
4. Pupil’s arrival and departure texted to the parentArrival and departure texted to the family · turnstile → schedule → webhook
5. School lockdown from one button, every door loggedLockdown: every door shut from one button · rule → relay → report+ 1 other field
6. University exam candidate matched to their registration photoCandidate matched to the photo they registered with · face ID → compare → report+ 1 other field
7. Looking at a neighbour’s paper, passing notes, hidden earpiecesCheating in an exam: glances, notes, hidden devices · pose + custom detector → rule → review+ 1 other field
8. Exam hall set with desks spaced as the rules sayRoom set up as ordered: chairs, tables, stage · COCO object → counter → compare → report+ 1 other field
9. Pupil leaving the grounds during lessonsSomeone leaving the grounds when they should stay · person → zone → schedule → alert+ 2 other fields
10. Every pupil who boarded the school bus got offNobody left inside when it is locked up · person + sensor → zone → counter → alert+ 2 other fields
11. Phone in a candidate’s hand during the examPhone in hand where it is not allowed · pose + COCO object → phone use → review+ 3 other fields
12. Library desks held with a coat for hoursBooked or reserved, and nobody there · any-object (YOLOE) → zone → timer → webhook+ 3 other fields
13. Cars speeding past the school gate at drop-offVehicle over the speed limit for the place · vehicle → tracker → speed → snapshot+ 4 other fields
14. Canteen plate waste logged by dishFood thrown away, logged by dish · custom detector + sensor → classify → report+ 4 other fields
15. Damp creeping up a classroom wallDamp and mould spreading on walls and ceilings · segment → trend → report+ 4 other fields
16. Classes counted out at the assembly point in a drillEvacuation watched live: exits used, floors cleared · person → line → counter → report+ 6 other fields
17. Lecture attendance counted in every hallHow much each room, bay or machine is really used · person + vehicle → zone → counter → report+ 6 other fields
18. Crowding on the stairs at the bellCrowd too dense: people per square metre · person → zone → counter → alert+ 7 other fields
19. Car driving into the playground in school hoursVehicles, carts or scooters in a space kept for people · any-object (YOLOE) → zone → schedule → alert+ 7 other fields
20. School gate left open during lessonsDoor held open or forced · door event + person → timer → alert+ 7 other fields
21. Invigilator out of the hall, or no teacher in the lab with pupilsPost manned: a work position empty too long · person → post → timer → alert+ 9 other fields
22. Coaches idling at the school gateEngines and equipment running when nobody needs them · motion + thermal camera → timer → alert+ 10 other fields
23. Someone on the school grounds at nightIntrusion: someone inside the fence or a closed zone · person → zone → PTZ → alert+ 14 other fields
24. Goggles on in the science labProtective kit worn where the job needs it · person + custom detector → zone → alert+ 20 other fields

Show all 24

21 solutions · 3 only here

Livestock & dairy farms

Are they all here, and is every animal fed, watered and well?

Built fromzonecustom detectoranimaltimerrulecustom posemeasuretrendtrackersegmentpersonproximityany-object (YOLOE)line

Build this for my site

1. Cow in heat, from mounting at nightanimal → tracker → rule → alert
2. Calving pen watched at night: cow down and strainingBirth under way: animal down and straining · custom pose → timer → alert
3. Grass left in each paddock, measured from the airdrone video → segment → measure → report
4. Cows or sheep through a gate left open, or into the cropAnimals out on the road, the crop or the wrong field · animal → zone → alert+ 1 other field
5. Cow limping on the way back from milkingLameness spotted from how an animal walks · custom pose → tracker → trend → alert+ 1 other field
6. Hours each cow spends lying in the cubiclesTime budget per animal: lying, eating, pacing · animal → zone → timer → report+ 1 other field
7. Time each group waits in the holding pen before milkingAnimals kept waiting in a pen too long · animal → zone → timer → alert+ 1 other field
8. Cattle weight and body condition estimated as they walk pastAnimal weight, growth and condition estimated on camera · segment → measure → trend → report+ 1 other field
9. Sheep caught in a fence or stuck on its backAnimal caught in a fence, grid or ditch · animal → zone → timer → alert+ 1 other field
10. Locust swarm heading for the pastureLocust swarm arriving over the fields · tile → custom detector → trend → alert+ 1 other field
11. Someone riding on a tractor drawbar or trailer hitchSomeone riding on forks, a bucket or a drawbar · person + custom detector → proximity → alert+ 2 other fields
12. Wolves or jackals near the sheep pen at nightPredators near the stock · any-object (YOLOE) → zone → schedule → alert+ 2 other fields
13. Horse rolling and pawing: early signs of colicAnimals in distress: rolling, panting, gasping · custom pose + custom detector → rule → alert+ 2 other fields
14. Cows, sheep and horses counted, and through each gateAnimal headcount: all present, and through each gate · animal + custom detector → line → counter → report+ 3 other fields
15. Sheep shorn per shearer for payOutput per worker for piece-rate pay · custom detector → line → counter → payroll+ 4 other fields
16. Tipper trailer raised under the farmyard power lineBoom or tipper raised near an overhead power line · custom detector → zone → measure → alert+ 5 other fields
17. Tractors and machinery near peopleNear miss between a person and a moving machine · person + any-object (YOLOE) → proximity → speed → alert+ 6 other fields
18. Fence post down along the paddockBroken fittings found: glass, seats, nets, racking · custom detector → compare → report+ 8 other fields
19. Water trough empty, or feed pushed out of reachRunning empty: shelf, bin, tray or feeder to refill · custom detector → zone → rule → alert+ 9 other fields
20. Manure scraper or feed robot stuckMachine running, idle or stopped, minute by minute · motion + colour → zone → timer → report+ 10 other fields
21. Teat dip applied to every cow in the parlourSteps of a procedure done, and in the right order · pose → zone → sequence → alert+ 11 other fields

Show all 21

23 solutions

Mining & quarries

Who is in the danger zone, and who is still underground?

Built frommeasurezonesegmentcustom detectorpersontimervehiclemotionscheduleclassifyface IDruletrendcustom pose

Build this for my site

1. Haul-truck driver nodding off in the cabDriver drowsy or distracted at the wheel · custom pose → timer → alert+ 1 other field
2. Oversize rocks on the crusher feedOversize lumps on the crusher feed · segment → measure → relay+ 1 other field
3. Haul truck loaded to the right level at the shovelTruck or trailer loaded to the right level · segment → measure → report+ 1 other field
4. Miners still underground after the shift, per shaftRoll-call: who is still inside, and who got out · sensor + face ID → cross-camera → report+ 2 other fields
5. Light vehicle too close to a haul truck on the rampFollowing or passing too close to another vehicle · vehicle → tracker → measure → alert+ 2 other fields
6. Ore stockpile tonnage from a drone flightStockpile volume from a drone flight · drone video → SAM → measure → report+ 2 other fields
7. Rockfall from the pit wallRock, snow or mud sliding down a slope · motion → segment → alert+ 3 other fields
8. Haul-truck driver unbelted in the cabSeatbelt or helmet not worn while driving or riding · vehicle + custom detector → rule → snapshot+ 4 other fields
9. Rip or tear on the ore conveyor beltLine flow fault: tear, jam, spill or fallen item · segment + motion → rule → relay+ 4 other fields
10. Person on the conveyor walkway while the belt runsMachine stopped when someone steps into its danger zone · person → zone → relay+ 5 other fields
11. Dump truck tipping under the pit’s overhead lineBoom or tipper raised near an overhead power line · custom detector → zone → measure → alert+ 5 other fields
12. Pre-shift safety briefing at the pit, and who missed itSafety briefing held, and who attended · face ID → zone → schedule → report+ 5 other fields
13. Hot idlers on the conveyor, from a thermal cameraHot spots on equipment from a thermal camera · thermal camera → heatmap → alert+ 5 other fields
14. Crusher and conveyor vibration read from videoVibration measured from video, before a bearing fails · motion → measure → trend → alert+ 5 other fields
15. Dust clouds on the haul road with the sprays offDust or smoke over the limit · segment → measure → alert+ 5 other fields
16. Dust on the haul roads cutting visibilityVisibility in fog or dust, measured from the camera · classify → measure → alert+ 5 other fields
17. Crew in the open pit through the midday heat with no breakToo long in the heat or the cold without a break · person → zone → schedule + timer → alert+ 6 other fields
18. Bucket teeth missing, tyre cuts at the washdown bayWear parts worn out: teeth, tyres, cables, pads · custom detector → classify → report+ 6 other fields
19. Haul trucks queuing at the shovel and the crusherEach vehicle’s time at each stop, and for how long · vehicle + COCO object → zone → timer → report+ 9 other fields
20. Cracks and seepage on the tailings dam wallStructure wearing out: cracks, corrosion, loose parts · custom detector + segment → trend → report+ 9 other fields
21. Ore grade estimated from the colour of rock on the beltGraded by size and colour, then sorted · custom detector → classify → relay+ 12 other fields
22. Person inside the blast radius before firingPerson inside a hazard zone while it is live · person → zone → schedule → alert + relay+ 14 other fields
23. Respirator on in the crusher houseProtective kit worn where the job needs it · person + custom detector → zone → alert+ 20 other fields

Show all 23

33 solutions · 2 only here

Ports & container terminals

Is anyone under the cranes, and is every box where the system says?

Built fromcustom detectorzonepersonruletimerscheduleOCRtrackerclassifycomparemeasurebarcodevehiclecounter

Build this for my site

1. Twistlocks left on a box as it landscustom detector → rule → alert
2. Ship’s draught marks read at the berthcustom detector + OCR → measure → report
3. Moves per hour for each quay craneMoves or lifts per hour for each crane · custom detector → tracker → counter → report+ 1 other field
4. Reefer display temperatures read in the stackDials and displays read by camera, alarm out of range · custom pose + OCR → measure → rule → alert+ 1 other field
5. Reefer container unplugged in the stackReefer container or trailer left unplugged · custom detector → rule → alert+ 1 other field
6. Mooring line slack or parted at the berthcustom detector → trend → alert+ 1 other field
7. Person overboard from the quay edgeSomeone in trouble in the water · person → tracker → timer → alert+ 2 other fields
8. Swimmers in the harbour basinSomeone in the water where or when it is banned · person → zone → schedule → alert+ 2 other fields
9. Quay cranes’ booms closing in on each otherCrane jibs or booms swinging into each other · custom detector → tracker → proximity → alert+ 2 other fields
10. Box doors opened in the stackTrailer or container doors opened in the yard · classify + person → schedule → alert+ 2 other fields
11. Container loaded onto the wrong truck at the stackLoad put on the wrong vehicle or the wrong pile · custom detector + plate OCR → compare → alert+ 2 other fields
12. Trailer landing legs still down as it leaves the stackTrailer coupled right before it pulls away · custom detector → classify → alert+ 2 other fields
13. Each box followed from the quay to its stackEach pallet or parcel followed from the dock to its place · custom detector + barcode → cross-camera → webhook+ 2 other fields
14. Container set down in the wrong slot in the stackStock put away in the wrong place · barcode + custom detector → zone → compare → alert+ 3 other fields
15. Oil sheen in the harbour basinOil spilled on the ground or the water · colour + segment → rule → alert+ 3 other fields
16. Cargo passed over the terminal fence at nightGoods thrown over the fence to someone outside · motion → tracker → line → alert+ 4 other fields
17. Container X-ray scans checked against the manifestX-ray image checked for hidden or dangerous goods · custom detector → classify → review+ 4 other fields
18. Deck containers lashed before the ship sailsLoad unsecured, or fallen off on the way · vehicle + custom detector → rule → alert+ 4 other fields
19. Truck forcing the terminal gateVehicle forcing its way through a barrier or gate · vehicle → speed → line → alert+ 5 other fields
20. Lashing crew briefed before the ship is workedSafety briefing held, and who attended · face ID → zone → schedule → report+ 5 other fields
21. Dents and holes in each box at the gateDamage at handover: new since the last check-in · custom detector → compare → snapshot → report+ 5 other fields
22. Containers per stack against the yard systemStock counted where it stands, against the system · custom detector → zone → counter → report+ 5 other fields
23. Fog over the harbour closing the berthsVisibility in fog or dust, measured from the camera · classify → measure → alert+ 5 other fields
24. Straddle carrier passing close to someone on footNear miss between a person and a moving machine · person + any-object (YOLOE) → proximity → speed → alert+ 6 other fields
25. Lashers on the quay through the midday heatToo long in the heat or the cold without a break · person → zone → schedule + timer → alert+ 6 other fields
26. Ship time alongside, berth by berthTurnaround: time from one use to the next · person + COCO object → zone → timer → report+ 6 other fields
27. Container numbers read at the gate and the craneUnit numbers read and logged: containers, wagons, VINs, serials · custom detector → OCR → webhook+ 8 other fields
28. Truck turnaround in the terminal, gate to gateEach vehicle’s time at each stop, and for how long · vehicle + COCO object → zone → timer → report+ 9 other fields
29. Trucks idling in the gate queueEngines and equipment running when nobody needs them · motion + thermal camera → timer → alert+ 10 other fields
30. Hazard labels on a box checked against the dangerous-goods listLabel and code present, straight and right · OCR + barcode → compare → relay+ 11 other fields
31. Person in the crane lane, or a driver out of the cab in the stackPerson inside a hazard zone while it is live · person → zone → schedule → alert + relay+ 14 other fields
32. Someone climbing onto the quay from the water after darkIntrusion: someone inside the fence or a closed zone · person → zone → PTZ → alert+ 14 other fields
33. Life jacket on at the quay edgeProtective kit worn where the job needs it · person + custom detector → zone → alert+ 20 other fields

Show all 33

20 solutions

Car parks & parking

Which bays are free, and who has stayed too long?

Built fromvehicleplate OCRtrackertimerzonecomparecolourspeedmeasurelinecountercustom detectorrulesegment

Build this for my site

1. Drivers circling for a bay, and for how longDrivers circling for a space, and for how long · vehicle → tracker → timer → report+ 1 other field
2. Plates on a hotlist flagged at the entrancePlates on a hotlist flagged as they pass · vehicle → plate OCR → watchlist → alert+ 1 other field
3. Van too tall for the car-park entranceVehicle too tall for the bridge or entrance ahead · vehicle → measure → relay+ 1 other field
4. Parked car scraped, with the plate of the car that did itDamage caused by a vehicle, with its plate · vehicle → tracker → plate OCR → snapshot+ 1 other field
5. Car across two bays, or in a disabled bay without a permitParking bay misused: across two, or no right to it · vehicle + plate OCR → zone → compare → alert+ 2 other fields
6. Ticketless entry and exit by number plateBarrier opened by number plate, no ticket or card · plate OCR → timer → relay+ 2 other fields
7. Car tailgating out of the car park without payingVehicle leaving without paying · plate OCR + sensor → compare → alert+ 2 other fields
8. Vehicles in and out across a lineVehicles counted by class, in and out · vehicle → line → counter → report+ 3 other fields
9. Free bays counted and shown on the sign at each levelFree parking bays counted and shown · vehicle → zone → counter → webhook+ 3 other fields
10. Car driving up the exit ramp the wrong wayGoing the wrong way through a one-way point · vehicle + person → direction → alert+ 3 other fields
11. Car-park drains blocked with litterDrains and gullies blocked before the rain · custom detector → rule → report+ 3 other fields
12. Oil leaking from a parked carOil spilled on the ground or the water · colour + segment → rule → alert+ 3 other fields
13. Car-park ramps icy and not grittedSnow and ice left where it must be cleared · segment → measure → report+ 3 other fields
14. Cars speeding down the car-park rampsVehicle over the speed limit for the place · vehicle → tracker → speed → snapshot+ 4 other fields
15. Exit ramps jammed after an eventCongestion building: speeds dropping, queues growing · vehicle → tracker → speed → alert+ 4 other fields
16. Car smashing through the exit barrierVehicle forcing its way through a barrier or gate · vehicle → speed → line → alert+ 5 other fields
17. Car leaving on a plate that belongs to a different carPlate that does not match the car: cloned or swapped · plate OCR + classify + colour → compare → alert+ 5 other fields
18. Overstay and no-stopping zonesVehicle stopped too long where time is limited · vehicle → zone → timer → alert+ 8 other fields
19. Exit barrier stuck openMachine running, idle or stopped, minute by minute · motion + colour → zone → timer → report+ 10 other fields
20. Car fire in the car parkFlame or smoke spotted early, indoors or on the horizon · custom detector + thermal camera → PTZ → alert+ 12 other fields

Show all 20

20 solutions · 3 only here

Fuel stations

Is the forecourt safe, and did every car pay?

Built fromrulecustom detectorcomparezonevehicleOCRplate OCRposepersonany-object (YOLOE)countersensorcolourtimer

Build this for my site

1. Passengers still in the car during gas refuellingPassengers still in the car while it is filled with gas · vehicle + person → zone → alert
2. Gas cylinder certificate checked before a CNG car is filledGas cylinder certificate checked before filling · OCR → rule → alert
3. Petrol poured into plastic canistersany-object (YOLOE) → zone → alert
4. Fill-ups counted by plate for a free washLoyalty counted by number plate, no card · plate OCR → counter → webhook+ 1 other field
5. Car driving off with the nozzle still inCar driving off still connected to the pump or charger · custom detector + vehicle → rule → alert+ 1 other field
6. Price board matches the pump pricePrice shown that differs from the price charged · OCR + sales CSV → compare → alert+ 1 other field
7. Tanker driver away from the truck during unloadingOperator at the controls and watching when it matters · pose → post → rule → alert+ 2 other fields
8. Tanker chocked before it unloadsWheel chocks in before loading starts · custom detector → rule → relay+ 2 other fields
9. Skimmer fitted to a pump’s card readerSkimmer fitted to a card reader · custom detector → compare → alert+ 2 other fields
10. Drive-off without paying, plate on the reportVehicle leaving without paying · plate OCR + sensor → compare → alert+ 2 other fields
11. Tanker hose on the wrong tank, or petrol lifted for a diesel carWrong hose, arm or nozzle on the tank before it is filled · OCR + custom detector → compare → alert+ 2 other fields
12. Tanker unloading with the earth clamp offEarth clamps off during loading or live work · custom detector → rule → alert+ 2 other fields
13. Cashier held up at the forecourt kioskDuress: hands raised in a hold-up · pose → hands raised → alert+ 3 other fields
14. Fuel spilled on the forecourtOil spilled on the ground or the water · colour + segment → rule → alert+ 3 other fields
15. Fuel dispensed with no car at the pumpTill exceptions: no scan, no sale, cash off the books · pose + sensor → compare → review+ 4 other fields
16. Drive-off car on false plates, caught by its make and colourPlate that does not match the car: cloned or swapped · plate OCR + classify + colour → compare → alert+ 5 other fields
17. Cigarette lit at the pumpSmoking where a spark is dangerous · any-object (YOLOE) → zone → alert+ 5 other fields
18. Car left at the pump while the driver shopsVehicle stopped too long where time is limited · vehicle → zone → timer → alert+ 8 other fields
19. Flame at a pump: emergency fuel stopFlame or smoke spotted early, indoors or on the horizon · custom detector + thermal camera → PTZ → alert+ 12 other fields
20. Pumps idle while cars queue at the othersQueue length and wait, with a call to open another point · person + vehicle → zone → counter + timer → alert+ 15 other fields

Show all 20

28 solutions

Food production & kitchens

Is every cook dressed right, the kitchen clean, and every batch safe?

Built fromcustom detectorzonecompareclassifycolourposesequencerulesegmentmeasurecounterpersontrendOCR

Build this for my site

1. Loaf crust colour and dough rise checkedBaked, dried or risen to the right point · colour + segment → measure → relay+ 1 other field
2. Frying oil too dark to use againcolour → trend → alert+ 1 other field
3. Colonies counted on swabs from the lineBacterial colonies counted on each plate · custom detector → counter → report+ 1 other field
4. Tasting from the cooking spoon, then stirring with itUnhygienic habits: face touched, spoon tasted and reused · pose + COCO object → sequence → review+ 1 other field
5. Staff walking from raw prep into the ready-to-eat areaCrossing from a dirty zone into a clean one · colour → zone → alert+ 1 other field
6. Hygiene-lock door that opens only for a hairnet and coatDoor or turnstile that opens only when the kit is on · person + custom detector → rule → relay+ 2 other fields
7. Cooking time per dish from order to passCycle time per task at a manual station · pose → zone → timer → report+ 2 other fields
8. Raw meat cut on a board that isn’t redColour-coded boards, cloths and tools used where they belong · colour + custom detector → rule → alert+ 2 other fields
9. Portions on the line judged against the specPortion size on every plate or pack · segment → measure → compare → review+ 2 other fields
10. Cakes decorated as the order photo showsMade as the approved sample: print, stitching, plating · custom detector → compare → review+ 3 other fields
11. Gas burner left lit after closingHeater, burner or iron left on after closing · custom detector → schedule → alert+ 3 other fields
12. Rats and cockroaches seen at nightPests and stray animals where food or stock is kept · motion → custom detector → heatmap → alert+ 3 other fields
13. Hands washed at the basin before going back to the lineHands washed or boots dipped before going in · person → zone → sequence → alert+ 4 other fields
14. Hand near the slicer blade with the guard upHands too close to a blade, needle or rollers · pose + custom detector → rule → review+ 4 other fields
15. Newer batches used before older ones in the cold roomNewest stock picked before the oldest · OCR → sequence → review+ 4 other fields
16. Food thrown away at each station, logged by dishFood thrown away, logged by dish · custom detector + sensor → classify → report+ 4 other fields
17. LPG cylinders standing loose by the burnersGas cylinders standing without a chain or cage · custom detector → rule → alert+ 5 other fields
18. Tray seals and lids closed on ready mealsPacks closed and intact: caps, flaps, bags, straps · custom detector → classify → relay+ 6 other fields
19. Deliveries counted in against the order at the back doorGoods counted onto or off each vehicle · custom detector → line → counter → report+ 6 other fields
20. Grease building up in the extractor hoodBuild-up that needs cleaning: grease, lint, dust, ice · classify → trend → report+ 6 other fields
21. Biscuits broken or out of shape on the cooling beltSize and position measured against the drawing · segment → measure → compare → relay+ 7 other fields
22. Plastic or metal pieces on the product beltForeign objects in the product or the feed · custom detector → classify → relay+ 7 other fields
23. Pizza toppings checked before it goes in the ovenEverything there: right parts, right count · custom detector → counter → compare → relay+ 10 other fields
24. Every batch probed for temperature before it is servedSteps of a procedure done, and in the right order · pose → zone → sequence → alert+ 11 other fields
25. Allergen label matches the recipe on the lineLabel and code present, straight and right · OCR + barcode → compare → relay+ 11 other fields
26. Smoke or a flare-up at the fryerFlame or smoke spotted early, indoors or on the horizon · custom detector + thermal camera → PTZ → alert+ 12 other fields
27. Mould or burnt spots on baked goodsSurface defects: scratches, cracks, stains and holes · custom detector → classify → relay+ 14 other fields
28. Cap, gloves and uniform on everyone at the stoveProtective kit worn where the job needs it · person + custom detector → zone → alert+ 20 other fields

Show all 28

15 solutions · 1 only here

Textile & garment

Is every machine running, every piece counted and every roll clean?

Built fromcustom detectorcompareclassifycountercolourrulesegmentmeasuretimerzonetilescheduleposeline

Build this for my site

1. Knot density measured on a hand-knotted carpettile → custom detector → counter → report
2. Dyed roll’s shade checked against the approved sampleColour and grain matched to the approved sample · colour → compare → report+ 2 other fields
3. Embroidery stitched as the artwork showsMade as the approved sample: print, stitching, plating · custom detector → compare → review+ 3 other fields
4. Steam irons left on at the pressing tablesHeater, burner or iron left on after closing · custom detector → schedule → alert+ 3 other fields
5. Fingers under the needle with the guard upHands too close to a blade, needle or rollers · pose + custom detector → rule → review+ 4 other fields
6. Garments finished per operator for piece-rate payOutput per worker for piece-rate pay · custom detector → line → counter → payroll+ 4 other fields
7. Seam wandering off the stitch lineJoints, seams and beads complete · custom detector + segment → measure → review+ 4 other fields
8. Lint and fly building up on the carding machineBuild-up that needs cleaning: grease, lint, dust, ice · classify → trend → report+ 6 other fields
9. Fabric width on the stenter, and garment size from a photoSize and position measured against the drawing · segment → measure → compare → relay+ 7 other fields
10. Operator at every sewing machine on the linePost manned: a work position empty too long · person → post → timer → alert+ 9 other fields
11. Cone running empty on the creel, or a warp beam running lowRunning empty: shelf, bin, tray or feeder to refill · custom detector → zone → rule → alert+ 9 other fields
12. Loom stopped on a broken threadMachine running, idle or stopped, minute by minute · motion + colour → zone → timer → report+ 10 other fields
13. Size tag on each garment matched to its cartonLabel and code present, straight and right · OCR + barcode → compare → relay+ 11 other fields
14. Silk cocoons graded by size and stainsGraded by size and colour, then sorted · custom detector → classify → relay+ 12 other fields
15. Holes, stains and broken threads on the fabric rollSurface defects: scratches, cracks, stains and holes · custom detector → classify → relay+ 14 other fields

18 solutions · 1 only here

Pharma, labs & cleanrooms

Is every unit right, and was every cleanroom rule kept?

Built fromcustom detectorpersonzonecomparecounterruleclassifymeasureposesequencedoor eventsegmenttimercolour

Build this for my site

1. Fume-hood sash raised above the safe linecustom detector → measure → alert
2. Eyewash station in use in the labSomeone at the safety shower or eyewash: help sent · person → zone → timer → alert+ 1 other field
3. A tablet of another colour, or the last batch left on the lineWrong product mixed into the batch · colour + custom detector → compare → relay+ 1 other field
4. Bacterial colonies counted on each platecustom detector → counter → report+ 1 other field
5. Gloved hand touching the face in a Grade A or B areaUnhygienic habits: face touched, spoon tasted and reused · pose + COCO object → sequence → review+ 1 other field
6. Airlock that opens only for a full cleanroom gownDoor or turnstile that opens only when the kit is on · person + custom detector → rule → relay+ 2 other fields
7. Running in the cleanroomRunning or racing where people must walk · person → speed → zone → alert+ 2 other fields
8. Both airlock doors open at onceBoth doors of an airlock or mantrap open at once · door event → rule → alert+ 2 other fields
9. Cleanroom door openings per batchDoor openings counted where every opening costs · door event → counter → report+ 2 other fields
10. Vials filled to the line before cappingFilled to the line, unit by unit · custom detector → segment → measure → relay+ 3 other fields
11. Spill on the lab bench or floorSpill or puddle where people walk · segment + YOLO-World → rule → alert+ 4 other fields
12. Crimp caps sealed on every vialPacks closed and intact: caps, flaps, bags, straps · custom detector → classify → relay+ 6 other fields
13. Particles floating in filled vialsForeign objects in the product or the feed · custom detector → classify → relay+ 7 other fields
14. Empty or broken pockets in every blisterEverything there: right parts, right count · custom detector → counter → compare → relay+ 10 other fields
15. Samples pipetted in the order the protocol setsSteps of a procedure done, and in the right order · pose → zone → sequence → alert+ 11 other fields
16. Batch code and expiry read on every cartonLabel and code present, straight and right · OCR + barcode → compare → relay+ 11 other fields
17. Chipped or cracked tablets rejectedSurface defects: scratches, cracks, stains and holes · custom detector → classify → relay+ 14 other fields
18. Lab coat and goggles on at the benchProtective kit worn where the job needs it · person + custom detector → zone → alert+ 20 other fields

24 solutions

Residential & housing

Who came in, and is anything where it should not be?

Built fromcustom detectorzonerulepersonmotioncomparetimertrendany-object (YOLOE)trackerposecross-cameradrone videosegment

Build this for my site

1. Something thrown from a high windowSomething thrown or dropped from height · motion → tracker → speed → alert+ 1 other field
2. Stranger trying door handles along a corridorSomeone trying door after door · pose → cross-camera → rule → alert+ 1 other field
3. Satellite dishes and AC units hung on the facade without approvalBuilding work without a permit, found from above · drone video → segment → compare → report+ 1 other field
4. Dog mess left on the lawn by its walkerDog mess left behind by its walker · animal + person → sequence → snapshot+ 1 other field
5. Recycling bins filled with the wrong wasteWrong waste in the recycling stream · custom detector → classify → report+ 1 other field
6. Mailboxes being forced in the lobbySmash-and-grab or a machine being forced open · custom detector + pose → rule → alert+ 2 other fields
7. Car parked in someone else’s numbered bayParking bay misused: across two, or no right to it · vehicle + plate OCR → zone → compare → alert+ 2 other fields
8. Residents’ cars let through the gate by plateBarrier opened by number plate, no ticket or card · plate OCR → timer → relay+ 2 other fields
9. Flat meters read in the basementUtility meters read by camera, digits or spinning disc · OCR + motion → trend → report+ 2 other fields
10. Barbecue lit on a balconyOpen fire where fires are banned · custom detector → schedule → alert+ 2 other fields
11. Rubbish dumped beside the bins, not in themRubbish dumped where it should not be · custom detector → zone → snapshot+ 2 other fields
12. Residents let in by face at the lobby doorDoors opened by face: no card to lose or lend · face ID → rule → relay+ 3 other fields
13. The lobby’s night summed up in one minuteA night of footage summed up in one minute · motion → tracker → clip+ 3 other fields
14. Icicles hanging over the entranceIce or snow building up where it can fall or overload · custom detector → measure → alert+ 3 other fields
15. Dead branches hanging over the estate car parkLeaning or dead trees near paths and roads · drone video → classify → report+ 3 other fields
16. Basement car park floodingWater rising: river gauges, rain gauges, underpasses · custom detector → measure → trend → alert+ 4 other fields
17. Damp and mould spreading in a stairwellDamp and mould spreading on walls and ceilings · segment → trend → report+ 4 other fields
18. Smoking in the stairwellSmoking where a spark is dangerous · any-object (YOLOE) → zone → alert+ 5 other fields
19. Parcels left in the lobby overnightObject left behind by its owner · any-object (YOLOE) → timer → cross-camera → alert+ 6 other fields
20. Car driven along the estate’s footpathsVehicles, carts or scooters in a space kept for people · any-object (YOLOE) → zone → schedule → alert+ 7 other fields
21. Lobby door propped open at nightDoor held open or forced · door event + person → timer → alert+ 7 other fields
22. Bike wheeled out of the bike room at nightValuable or equipment taken from its place · person + custom detector → zone → rule → alert+ 7 other fields
23. Broken swing or slide on the playgroundBroken fittings found: glass, seats, nets, racking · custom detector → compare → report+ 8 other fields
24. Someone on the roof of the blockIntrusion: someone inside the fence or a closed zone · person → zone → PTZ → alert+ 14 other fields

Show all 24

17 solutions · 2 only here

Bazaars & markets

How busy is each aisle, and is every stall open?

Built fromcustom detectorzonepersontrackertimerOCRposeruleany-object (YOLOE)schedulecountercomparetrendmotion

Build this for my site

1. Scale turned away from the buyer, or off the control scaleScales honest and turned where the buyer can see · custom detector + OCR → compare → alert
2. Prices on the stall boards read daily for the price indexPrices read off the boards for a price index · OCR → trend → report
3. Goods slipped into a bag at a stallGoods slipped into a bag or pocket · pose + tracker → rule → review+ 1 other field
4. Traders setting up on the pavement outside the gateUnlicensed traders setting up · person + custom detector → zone → alert+ 1 other field
5. Stray dogs in the meat and fish rowsPests and stray animals where food or stock is kept · motion → custom detector → heatmap → alert+ 3 other fields
6. Gas cylinders inside the food stallsThings brought where they are not allowed · any-object (YOLOE) → zone → alert+ 5 other fields
7. Rubbish piling up in the rows at closingLitter on the ground, picked or not · custom detector → schedule → report+ 5 other fields
8. Crowd suddenly scattering along a rowCrowd suddenly running: many people fleeing at once · person → tracker → speed → alert+ 6 other fields
9. Crowd density per aisle, in people per m²Crowd too dense: people per square metre · person → zone → counter → alert+ 7 other fields
10. Porters’ carts pushing through the rows at peak hoursVehicles, carts or scooters in a space kept for people · any-object (YOLOE) → zone → schedule → alert+ 7 other fields
11. Hand into a shopper’s bag in a crowded rowTheft from a person: pickpocket or bag snatch · pose + tracker → proximity → review+ 7 other fields
12. Shoppers per row and hour, to price the stall rentsFootfall: people in and out, by hour · person → line → counter → report+ 7 other fields
13. Delivery vans in the loading area outside delivery hoursVehicle stopped too long where time is limited · vehicle → zone → timer → alert+ 8 other fields
14. Stalls open on time, vendor presentPost manned: a work position empty too long · person → post → timer → alert+ 9 other fields
15. Fish counter left without iceRunning empty: shelf, bin, tray or feeder to refill · custom detector → zone → rule → alert+ 9 other fields
16. Goods spread into the aisle beyond the stall lineSomething blocking a way or kit that must stay clear · tile → custom detector → zone → timer → alert+ 12 other fields
17. Fish freshness judged from eye and gill colourGraded by size and colour, then sorted · custom detector → classify → relay+ 12 other fields

15 solutions · 1 only here

Museums & heritage sites

Did anyone get too close to an exhibit, and which ones do people stop at?

Built fromzonepersoncustom detectorrulecomparecountertrendposecolourclassifyCOCO objecttrackerheatmapany-object (YOLOE)

Build this for my site

1. Daylight falling on a light-sensitive exhibitcolour → zone → trend → alert
2. Display case left unlocked after cleaningShowcase left unlocked with nobody beside it · classify + person → rule → alert+ 1 other field
3. Too close to an exhibit, in metres, or a hand on itToo close to something protected, in metres · person → zone → alert+ 1 other field
4. Flash photographyPhotos or filming where they are banned · pose + COCO object → zone → alert+ 2 other fields
5. Time spent at each exhibit, rankedWhere people stop, and for how long · person → tracker → heatmap → report+ 2 other fields
6. Painting moved or tilted since the morning photoChanged from its reference photo: 5S, cabling, layout · custom detector → compare → alert+ 3 other fields
7. Visitors climbing a heritage wall or sitting on old furnitureClimbing, standing or sitting where it is not allowed · pose → zone → rule → alert+ 5 other fields
8. Food, drink, tripods and selfie sticks in the galleriesThings brought where they are not allowed · any-object (YOLOE) → zone → alert+ 5 other fields
9. Galleries cleared room by room after an alarmEvacuation watched live: exits used, floors cleared · person → line → counter → report+ 6 other fields
10. Exhibit missing from its plinthValuable or equipment taken from its place · person + custom detector → zone → rule → alert+ 7 other fields
11. Visitors through the gates against tickets soldHeadcount against tickets and transactions · person + vehicle + sensor → counter → compare → review+ 7 other fields
12. Crack in a display case’s glassBroken fittings found: glass, seats, nets, racking · custom detector → compare → report+ 8 other fields
13. Room occupancy against its safe capacityHow full it is right now, against capacity · person → zone → counter → webhook+ 9 other fields
14. Tiles and plaster falling from a monument, tracked over monthsStructure wearing out: cracks, corrosion, loose parts · custom detector + segment → trend → report+ 9 other fields
15. Night digging at an archaeological siteIntrusion: someone inside the fence or a closed zone · person → zone → PTZ → alert+ 14 other fields

20 solutions · 12 only here

Workforce & attendance

Who was at work, for how long, and does the payroll match?

Built fromattendanceface IDscheduletimerpersonzonepostcounterposesensorcustom detectormeal limittrendsequence

Build this for my site

1. Staff gathering instead of workingperson → post → counter → alert
2. Shift rotas: 2-on-2-off, nights, moving rest daysschedule → attendance → report
3. Late arrivals and early leavers, each with a reason and a verdictLate arrivals and early leavers, with a reason and a verdict · attendance → schedule → review
4. Payroll file per employee and periodattendance → schedule → payroll
5. Canteen meals by face, with a daily limitface ID → meal limit → report
6. Days off and rota changes requested in the appschedule → review → report
7. Staff scorecard: violations, lateness, salesreview + attendance → report
8. Break length per person against the allowed 30 minBreak length against what is allowed · face ID → attendance → timer → review
9. Overtime beyond the rota, sent for approvalattendance → schedule → review
10. Hours per project from where each person workedface ID → zone → timer → report
11. Absence patterns: Mondays and the day after holidaysattendance → trend → report
12. Shift handover: the next crew in before the last one leavesface ID → post → sequence → alert
13. Sleeping on shiftAsleep on duty · pose → posture → timer → review+ 1 other field
14. Evacuation roll-call on an alarmRoll-call: who is still inside, and who got out · sensor + face ID → cross-camera → report+ 2 other fields
15. Turnstile check-ins, badge checked against the faceBadge used by someone other than its owner · turnstile + face ID → reconcile → report+ 2 other fields
16. Phone use at the workstationPhone in hand where it is not allowed · pose + COCO object → phone use → review+ 3 other fields
17. Staff canteen plate waste logged by dishFood thrown away, logged by dish · custom detector + sensor → classify → report+ 4 other fields
18. Presence and hours on siteHours on site by face: staff, contractors, trainers · face ID → attendance → report+ 6 other fields
19. Canteen queue at lunch, with a call to open another tillQueue length and wait, with a call to open another point · person + vehicle → zone → counter + timer → alert+ 15 other fields
20. Uniform and name badge on at the start of the shiftProtective kit worn where the job needs it · person + custom detector → zone → alert+ 20 other fields

Show all 20

33 solutions

Roads & traffic

Who broke the rules on this road, and where does the traffic jam?

Built fromvehiclezonepersonclassifyrulecustom detectormeasurescheduleplate OCRtrackercounterlinesegmentspeed

Build this for my site

1. Licence plates read and checked against police hotlistsPlates on a hotlist flagged as they pass · vehicle → plate OCR → watchlist → alert+ 1 other field
2. Cars with no plate, or one too dirty to readPlate covered, dirty or missing · plate OCR → rule → snapshot+ 1 other field
3. Solid-line changes, U-turns, bus lanes and banned trucksLane or turn rule broken: solid line, U-turn, bus lane · vehicle → tracker → zone → snapshot+ 1 other field
4. Driver not giving way at a pedestrian crossingDriver not giving way to people on a crossing · person + vehicle → zone → rule → snapshot+ 1 other field
5. Overheight truck approaching a low bridgeVehicle too tall for the bridge or entrance ahead · vehicle → measure → relay+ 1 other field
6. Overloaded trucks weighed in motion on the highwayOverloaded truck photographed on the scales · sensor + vehicle → plate OCR → snapshot+ 1 other field
7. Queue at each junction approach feeds the signal timingQueues at the lights fed to the signal timing: cars and walkers · vehicle + person → zone → counter → webhook+ 1 other field
8. Green light held for an ambulance at the junctionEmergency vehicles let through without stopping · vehicle → classify → relay+ 1 other field
9. Cars with one person in the car-pool laneOccupants counted for the car-pool lane · vehicle + person → counter → rule → snapshot+ 1 other field
10. Cows, sheep or horses wandering onto the roadAnimals out on the road, the crop or the wrong field · animal → zone → alert+ 1 other field
11. Tailgating on the motorway, gap in secondsFollowing or passing too close to another vehicle · vehicle → tracker → measure → alert+ 2 other fields
12. Counts by class: car, bus, truck, motorbike, bicycleVehicles counted by class, in and out · vehicle → line → counter → report+ 3 other fields
13. Wrong-way drivingGoing the wrong way through a one-way point · vehicle + person → direction → alert+ 3 other fields
14. Road drains blocked on the low stretchesDrains and gullies blocked before the rain · custom detector → rule → report+ 3 other fields
15. Ice forming on a bridge deck before grittingSnow and ice left where it must be cleared · segment → measure → report+ 3 other fields
16. Rocks fallen onto a mountain roadRock, snow or mud sliding down a slope · motion → segment → alert+ 3 other fields
17. Trees leaning over the carriageway after a stormLeaning or dead trees near paths and roads · drone video → classify → report+ 3 other fields
18. Speeding vehicles, km/h from the cameraVehicle over the speed limit for the place · vehicle → tracker → speed → snapshot+ 4 other fields
19. Red-light violationsRed light, stop sign or stop arm run · classify + vehicle → line → snapshot+ 4 other fields
20. Seatbelt off, or a motorcyclist without a helmetSeatbelt or helmet not worn while driving or riding · vehicle + custom detector → rule → snapshot+ 4 other fields
21. Load spilled across the carriagewayLoad unsecured, or fallen off on the way · vehicle + custom detector → rule → alert+ 4 other fields
22. Traffic slowing to a crawl on each stretch, and the queue behindCongestion building: speeds dropping, queues growing · vehicle → tracker → speed → alert+ 4 other fields
23. Roadside billboard content logged hour by hourAd screens showing the booked content, logged · classify → schedule → report+ 4 other fields
24. Water over the road at a dipWater rising: river gauges, rain gauges, underpasses · custom detector → measure → trend → alert+ 4 other fields
25. Cloned plates: the plate’s make and colour do not match the carPlate that does not match the car: cloned or swapped · plate OCR + classify + colour → compare → alert+ 5 other fields
26. Fog closing in: visibility in metres, signs setVisibility in fog or dust, measured from the camera · classify → measure → alert+ 5 other fields
27. Road crews laying asphalt through the midday heatToo long in the heat or the cold without a break · person → zone → schedule + timer → alert+ 6 other fields
28. Car driving into a coned-off roadworks zoneVehicles, carts or scooters in a space kept for people · any-object (YOLOE) → zone → schedule → alert+ 7 other fields
29. Pedestrians counted at crossingsFootfall: people in and out, by hour · person → line → counter → report+ 7 other fields
30. Traffic signal lamp out at a junctionLights, screens and signs dark when they should be on · classify → schedule → report+ 9 other fields
31. Crash or stalled car blocking a laneSomething blocking a way or kit that must stay clear · tile → custom detector → zone → timer → alert+ 12 other fields
32. Smoke in a road tunnelFlame or smoke spotted early, indoors or on the horizon · custom detector + thermal camera → PTZ → alert+ 12 other fields
33. Pedestrians crossing a highway away from any crossingPerson inside a hazard zone while it is live · person → zone → schedule → alert + relay+ 14 other fields

Show all 33

31 solutions

Smart city & streets

Which street needs a crew today, and why?

Built fromcustom detectorpersonzonemeasuresegmentvehiclerulecomparecounterscheduletrackertrendtimermotion

Build this for my site

1. Street camera lens dirty, fogged or turnedCamera covered, moved or out of focus · motion → compare → alert+ 1 other field
2. Passers-by blurred before street footage is sharedPeople blurred before a frame leaves the box · person → blur → clip+ 1 other field
3. Graffiti on facades and wallsGraffiti on walls, trains and shutters · custom detector → snapshot → report+ 1 other field
4. Street vendors blocking the pavementUnlicensed traders setting up · person + custom detector → zone → alert+ 1 other field
5. Drivers not giving way at zebra crossingsDriver not giving way to people on a crossing · person + vehicle → zone → rule → snapshot+ 1 other field
6. Walkers waiting at a crossing given a longer greenQueues at the lights fed to the signal timing: cars and walkers · vehicle + person → zone → counter → webhook+ 1 other field
7. Missed bin collections, street by streetBins emptied on every round, from the truck camera · custom detector → counter → report+ 1 other field
8. Dog mess left in the park by its walkerDog mess left behind by its walker · animal + person → sequence → snapshot+ 1 other field
9. Leaves and rubbish burned in a yardOpen fire where fires are banned · custom detector → schedule → alert+ 2 other fields
10. Rubble dumped from a truck on waste groundRubbish dumped where it should not be · custom detector → zone → snapshot+ 2 other fields
11. Lamp post leaning after a collisionKnocked out of line: antennas, trackers, tank roofs · custom detector → measure → compare → alert+ 3 other fields
12. Street gullies blocked with leaves before the rainDrains and gullies blocked before the rain · custom detector → rule → report+ 3 other fields
13. Snow and ice left on the pavementSnow and ice left where it must be cleared · segment → measure → report+ 3 other fields
14. Leaning or dead trees over pavements and parksLeaning or dead trees near paths and roads · drone video → classify → report+ 3 other fields
15. Crowd barrier pushed over at a street eventCrowd barrier pushed over, climbed or opened · person + custom detector → zone → rule → alert+ 4 other fields
16. Streets jamming around a market or an eventCongestion building: speeds dropping, queues growing · vehicle → tracker → speed → alert+ 4 other fields
17. Underpass flooding after rainWater rising: river gauges, rain gauges, underpasses · custom detector → measure → trend → alert+ 4 other fields
18. Manhole cover or road sign missingSafety kit or cover missing from its place · any-object (YOLOE) → rule → alert+ 5 other fields
19. Black smoke from a boiler chimneyDust or smoke over the limit · segment → measure → alert+ 5 other fields
20. Crowd suddenly scattering on a squareCrowd suddenly running: many people fleeing at once · person → tracker → speed → alert+ 6 other fields
21. Car driving into a pedestrian street in market hoursVehicles, carts or scooters in a space kept for people · any-object (YOLOE) → zone → schedule → alert+ 7 other fields
22. Phone snatched on a busy streetTheft from a person: pickpocket or bag snatch · pose + tracker → proximity → review+ 7 other fields
23. Visitors per hour in each parkFootfall: people in and out, by hour · person → line → counter → report+ 7 other fields
24. Water gushing from a burst mainLeak from a pipe, roof, tank or drum · segment → trend → alert+ 7 other fields
25. Double-parked vans blocking a laneVehicle stopped too long where time is limited · vehicle → zone → timer → alert+ 8 other fields
26. Smashed glass in a bus shelterBroken fittings found: glass, seats, nets, racking · custom detector → compare → report+ 8 other fields
27. Overflowing bins before the collection roundBin, tank or bag nearly full or nearly empty · segment → measure → alert+ 9 other fields
28. Streetlights out, street by streetLights, screens and signs dark when they should be on · classify → schedule → report+ 9 other fields
29. Potholes, cracks and worn markings, logged with their locationStructure wearing out: cracks, corrosion, loose parts · custom detector + segment → trend → report+ 9 other fields
30. Streetlights left on in daylightEngines and equipment running when nobody needs them · motion + thermal camera → timer → alert+ 10 other fields
31. Fallen tree across the road, e-scooters across the pavementSomething blocking a way or kit that must stay clear · tile → custom detector → zone → timer → alert+ 12 other fields

Show all 31

16 solutions · 3 only here

Checkpoints & access control

Who opened which door, and did anyone get in who should not have?

Built fromface IDturnstilerulepersonvehicleschedulezonecomparereconcileplate OCRtimerwatchlistbarcodesequence

Build this for my site

1. Access log from the turnstiles alone: no camera, no GPUturnstile → schedule → report
2. Roster pulled from the turnstilesStaff roster pulled from the access terminals · turnstile → report
3. Faces enrolled once and synced to every terminalface ID → turnstile → report
4. Lockdown: every door shut from one button, loggedLockdown: every door shut from one button · rule → relay → report+ 1 other field
5. Former employee’s face or badge at a doorBarred people spotted on any camera · face ID → watchlist → alert+ 1 other field
6. Visitor pass that expires when the visit endsVisitor pass by QR that expires when the visit ends · barcode → face ID → schedule → relay+ 1 other field
7. Visitor inside without their escortface ID + person → zone → rule → alert+ 1 other field
8. Under-vehicle check at a secure gateUnder-vehicle check on the way in · vehicle → snapshot → compare → review+ 1 other field
9. Badge lent to a colleague, caught by the face checkBadge used by someone other than its owner · turnstile + face ID → reconcile → report+ 2 other fields
10. Barrier raised for cars on the staff listBarrier opened by number plate, no ticket or card · plate OCR → timer → relay+ 2 other fields
11. Doors opened by face: no card to lose or lendface ID → rule → relay+ 3 other fields
12. Boot of every leaving car opened for the guardVehicle skipping a stop it must make: wash, check or scan · vehicle → zone → sequence → alert+ 3 other fields
13. Swipes that nobody walked through onTwo people through on one badge or ticket · turnstile + person → reconcile → alert+ 4 other fields
14. Car forcing its way through the barrier at the gateVehicle forcing its way through a barrier or gate · vehicle → speed → line → alert+ 5 other fields
15. Plate on the staff list, but on the wrong carPlate that does not match the car: cloned or swapped · plate OCR + classify + colour → compare → alert+ 5 other fields
16. Door alarms: forced, held open, out of hoursDoor held open or forced · door event + person → timer → alert+ 7 other fields

20 solutions

Hotels & resorts

Is every room turned round on time, and is every guest looked after?

Built fromzonetimercustom detectorpersonclassifyrulecountersensorvehicleposeCOCO objectcompareany-object (YOLOE)cross-camera

Build this for my site

1. Someone trying room door handles along a guest corridorSomeone trying door after door · pose → cross-camera → rule → alert+ 1 other field
2. Event hall set with the chairs and tables orderedRoom set up as ordered: chairs, tables, stage · COCO object → counter → compare → report+ 1 other field
3. Fire exit locked at nightExit locked when people may need it · classify → schedule → alert+ 2 other fields
4. Balcony door left open with the air conditioning onWindow or vent open against the heating, cooling or climate plan · classify + sensor → rule → alert+ 2 other fields
5. Sunbeds kept with a towel and left empty for an hourBooked or reserved, and nobody there · any-object (YOLOE) → zone → timer → webhook+ 3 other fields
6. Room made up to standard, checked from the maid’s photoCleaned properly: nothing missed, no streaks or spots · custom detector → classify → review+ 3 other fields
7. Minutes a guest waits at the kerb for the valetMinutes to serve each customer · person + vehicle → zone → timer → report+ 4 other fields
8. Buffet leftovers logged by dish after each serviceFood thrown away, logged by dish · custom detector + sensor → classify → report+ 4 other fields
9. Mould spreading in bathroom ceilingsDamp and mould spreading on walls and ceilings · segment → trend → report+ 4 other fields
10. Maintenance crew on a ladder in the lobby with nobody footing itLadder used unsafely: top step, over-reaching, unfooted · pose + custom detector → rule → alert+ 5 other fields
11. Trays and trolleys left in guest corridorsClutter left out: trays, trolleys, boxes, cables · any-object (YOLOE) → zone → timer → alert+ 5 other fields
12. Floors cleared and stairs used during a fire alarmEvacuation watched live: exits used, floors cleared · person → line → counter → report+ 6 other fields
13. Cleaning time per room, from the corridor cameraTurnaround: time from one use to the next · person + COCO object → zone → timer → report+ 6 other fields
14. Breakfast guests counted against rooms that include itHeadcount against tickets and transactions · person + vehicle + sensor → counter → compare → review+ 7 other fields
15. Luggage waiting at the kerb with no porter for 5 minCall for help or an alarm, and how long until someone comes · person + sensor → zone → timer → alert+ 8 other fields
16. Stored luggage matched to its tagsUnit numbers read and logged: containers, wagons, VINs, serials · custom detector → OCR → webhook+ 8 other fields
17. Buffet trays or pool towels running outRunning empty: shelf, bin, tray or feeder to refill · custom detector → zone → rule → alert+ 9 other fields
18. Fire exit corridor blocked by laundry trolleysSomething blocking a way or kit that must stay clear · tile → custom detector → zone → timer → alert+ 12 other fields
19. Stained or torn linen sorted out in the laundrySurface defects: scratches, cracks, stains and holes · custom detector → classify → relay+ 14 other fields
20. Queue at check-in, with a call to open another deskQueue length and wait, with a call to open another point · person + vehicle → zone → counter + timer → alert+ 15 other fields

Show all 20

19 solutions

Shopping malls

Which shop fronts pull people in, and is the building working?

Built frompersonzonetrackerschedulecountertimerlineclassifyposevehicleheatmapruledemographicsCOCO object

Build this for my site

1. Cars circling the mall car park for a spaceDrivers circling for a space, and for how long · vehicle → tracker → timer → report+ 1 other field
2. Capture rate at each shop, and shoppers leaving with bagsVisitors who become buyers · person → line → zone → report+ 1 other field
3. Anonymous age bands of visitors, entrance by entranceAnonymous sex and age bands · person → demographics → report+ 1 other field
4. Food-court tables left with trays for 10 minTables cleared in time: cups, plates, food · COCO object → table → timer → alert+ 1 other field
5. Fire exit chained shut in opening hoursExit locked when people may need it · classify → schedule → alert+ 2 other fields
6. Passers-by who stop at each shop windowWhere people stop, and for how long · person → tracker → heatmap → report+ 2 other fields
7. Free spaces in the mall car park shown at the entranceFree parking bays counted and shown · vehicle → zone → counter → webhook+ 3 other fields
8. Each advert on the mall screens logged for the advertiserAd screens showing the booked content, logged · classify → schedule → report+ 4 other fields
9. Drink spilled in the food courtSpill or puddle where people walk · segment + YOLO-World → rule → alert+ 4 other fields
10. Crowd leaning over the atrium balustradeClimbing, standing or sitting where it is not allowed · pose → zone → rule → alert+ 5 other fields
11. Shoppers suddenly running from one spot in the atriumCrowd suddenly running: many people fleeing at once · person → tracker → speed → alert+ 6 other fields
12. Floors cleared and exits used during an evacuationEvacuation watched live: exits used, floors cleared · person → line → counter → report+ 6 other fields
13. Trips counted at each escalator and step, week by weekTrips and stumbles counted by place, before someone falls · pose → tracker → heatmap → report+ 6 other fields
14. Cars on the plaza, or scooters ridden through the mallVehicles, carts or scooters in a space kept for people · any-object (YOLOE) → zone → schedule → alert+ 7 other fields
15. Phone snatched from a table in the food courtTheft from a person: pickpocket or bag snatch · pose + tracker → proximity → review+ 7 other fields
16. Footfall reports sent to each tenantFootfall: people in and out, by hour · person → line → counter → report+ 7 other fields
17. Food-court seats free, shown on screensHow full it is right now, against capacity · person → zone → counter → webhook+ 9 other fields
18. Digital ad screens blank during opening hoursLights, screens and signs dark when they should be on · classify → schedule → report+ 9 other fields
19. Fire hose reel blocked by a shop displaySomething blocking a way or kit that must stay clear · tile → custom detector → zone → timer → alert+ 12 other fields

Show all 19

24 solutions · 3 only here

Stadiums, cinemas & theatres

Is the crowd safe, and is every show running as sold?

Built frompersonzonecountercustom detectorposetrackerruleschedulelineclassifyvehiclecomparecolourtile

Build this for my site

1. Away fans crossing into the home sectorFans crossing into the other side’s sector · person + colour → zone → alert
2. Audience walking out in the first 20 minutes of a filmAudience walking out early · person → line → counter → report
3. Performer off their mark on stagepose → zone → review
4. Drone flying over the stadiumDrone flying where it should not · tile → custom detector → PTZ → alert+ 1 other field
5. Highlights for the big screen cut as they happenHighlights cut automatically: goals, shots, big moments · custom detector + tracker → rule → clip+ 1 other field
6. Pitch grass worn in patches, seen from the roof cameraPitch grass worn in patches · segment → trend → report+ 1 other field
7. Exit gates still locked as the crowd starts to leaveExit locked when people may need it · classify → schedule → alert+ 2 other fields
8. Phone held up filming the cinema screenPhotos or filming where they are banned · pose + COCO object → zone → alert+ 2 other fields
9. Fight breaking out between fans in the standsFight or violence breaking out · pose → tracker → rule → alert+ 3 other fields
10. Fans pushing over the barrier at the front of a standCrowd barrier pushed over, climbed or opened · person + custom detector → zone → rule → alert+ 4 other fields
11. Fans standing on the seats in a seated standClimbing, standing or sitting where it is not allowed · pose → zone → rule → alert+ 5 other fields
12. Litter left in the stands after each matchLitter on the ground, picked or not · custom detector → schedule → report+ 5 other fields
13. Fans suddenly surging away from one part of a standCrowd suddenly running: many people fleeing at once · person → tracker → speed → alert+ 6 other fields
14. Stands emptying, gate by gate, in an emergencyEvacuation watched live: exits used, floors cleared · person → line → counter → report+ 6 other fields
15. Crush risk building at a gate, in people per m²Crowd too dense: people per square metre · person → zone → counter → alert+ 7 other fields
16. Cinema seats filled against tickets sold, per showHeadcount against tickets and transactions · person + vehicle + sensor → counter → compare → review+ 7 other fields
17. Pickpocket working the crowd at the gatesTheft from a person: pickpocket or bag snatch · pose + tracker → proximity → review+ 7 other fields
18. Time to fill and to empty the stadium, gate by gateFootfall: people in and out, by hour · person → line → counter → report+ 7 other fields
19. Broken seats found after each matchBroken fittings found: glass, seats, nets, racking · custom detector → compare → report+ 8 other fields
20. Projector dark, dim or out of focus mid-showLights, screens and signs dark when they should be on · classify → schedule → report+ 9 other fields
21. Flares lit in the standsFlame or smoke spotted early, indoors or on the horizon · custom detector + thermal camera → PTZ → alert+ 12 other fields
22. Actor under a flying piece of sceneryPerson inside a hazard zone while it is live · person → zone → schedule → alert + relay+ 14 other fields
23. Pitch invasionIntrusion: someone inside the fence or a closed zone · person → zone → PTZ → alert+ 14 other fields
24. Queues at the food kiosks at half-timeQueue length and wait, with a call to open another point · person + vehicle → zone → counter + timer → alert+ 15 other fields

Show all 24

30 solutions

Railways & metro

Is the platform too full, and is anyone past the yellow line?

Built frompersonzonecustom detectorruleclassifyposevehiclecountersegmentmeasurescheduletrackertimerCOCO object

Build this for my site

1. Bag or person caught in the train doorsSomeone caught in closing doors · person + COCO object → zone → relay+ 1 other field
2. Graffiti on trains stabled in the depotGraffiti on walls, trains and shutters · custom detector → snapshot → report+ 1 other field
3. Boarding ramp put out for a wheelchair user at the doorRamp put out for a wheelchair user · person + custom detector → rule → report+ 1 other field
4. Seats slashed or windows scratched on a trainVandalism caught as it happens · pose → zone → rule → alert+ 2 other fields
5. Trees leaning towards the overhead lineTrees and shrubs growing into lines and panels · drone video → segment → measure → report+ 2 other fields
6. Bike racks and car park at the station: spaces freeFree parking bays counted and shown · vehicle → zone → counter → webhook+ 3 other fields
7. Snow packed in the points at a junctionSnow and ice left where it must be cleared · segment → measure → report+ 3 other fields
8. Crowd pushing through the barriers onto a closed platformCrowd barrier pushed over, climbed or opened · person + custom detector → zone → rule → alert+ 4 other fields
9. Fare-gate jumping, or two through on one ticketTwo people through on one badge or ticket · turnstile + person → reconcile → alert+ 4 other fields
10. Car crossing while the level-crossing lights flashRed light, stop sign or stop arm run · classify + vehicle → line → snapshot+ 4 other fields
11. Open wagon door or shifted load on a passing trainLoad unsecured, or fallen off on the way · vehicle + custom detector → rule → alert+ 4 other fields
12. Adverts on station screens logged as playedAd screens showing the booked content, logged · classify → schedule → report+ 4 other fields
13. Fog on the line: visibility at each signalVisibility in fog or dust, measured from the camera · classify → measure → alert+ 5 other fields
14. Passengers suddenly running on the concourseCrowd suddenly running: many people fleeing at once · person → tracker → speed → alert+ 6 other fields
15. Station emptied, exit by exit, after an alarmEvacuation watched live: exits used, floors cleared · person → line → counter → report+ 6 other fields
16. Trips counted on the platform stairs, week by weekTrips and stumbles counted by place, before someone falls · pose → tracker → heatmap → report+ 6 other fields
17. Bag left alone on the platformObject left behind by its owner · any-object (YOLOE) → timer → cross-camera → alert+ 6 other fields
18. Damage on the pantograph, seen from the depot cameraWear parts worn out: teeth, tyres, cables, pads · custom detector → classify → report+ 6 other fields
19. Passenger collapsed on the platformFall or collapse: someone down and not getting up · pose → person down → alert + relay+ 7 other fields
20. Platform too full: entry gates held until the next trainCrowd too dense: people per square metre · person → zone → counter → alert+ 7 other fields
21. Signal cable cut and pulled from the tracksideValuable or equipment taken from its place · person + custom detector → zone → rule → alert+ 7 other fields
22. Pickpocket working the crowd on a packed platformTheft from a person: pickpocket or bag snatch · pose + tracker → proximity → review+ 7 other fields
23. Wagon numbers read as a freight train passesUnit numbers read and logged: containers, wagons, VINs, serials · custom detector → OCR → webhook+ 8 other fields
24. Minutes each train stands at the platformEach vehicle’s time at each stop, and for how long · vehicle + COCO object → zone → timer → report+ 9 other fields
25. Passengers per carriage shown before the train arrivesHow full it is right now, against capacity · person → zone → counter → webhook+ 9 other fields
26. Signal lamp out on the lineLights, screens and signs dark when they should be on · classify → schedule → report+ 9 other fields
27. Missing clips and broken sleepers from a train cameraStructure wearing out: cracks, corrosion, loose parts · custom detector + segment → trend → report+ 9 other fields
28. Car stuck on a level crossingSomething blocking a way or kit that must stay clear · tile → custom detector → zone → timer → alert+ 12 other fields
29. Past the yellow line, or fallen onto the tracks: trains heldPerson inside a hazard zone while it is live · person → zone → schedule → alert + relay+ 14 other fields
30. Trespassers walking along the lineIntrusion: someone inside the fence or a closed zone · person → zone → PTZ → alert+ 14 other fields

Show all 30

28 solutions · 2 only here

Buses & public transport

How many rode, did the bus stop where it should, and is it back on time?

Built fromzonepersonvehiclesensortimerruleclassifycounterposecustom detectorlinetrackercompareschedule

Build this for my site

1. Bus driving past a stop where people are waitingperson + sensor → zone → rule → alert
2. Buses bunching: gaps between buses at a stopvehicle → counter → timer → report
3. Doors opened between stopsDoors open while the vehicle moves · classify + sensor → rule → alert+ 1 other field
4. Bus driver at the wheel past the hours limitSame driver at the wheel for too long · face ID → timer → alert+ 1 other field
5. Passenger standing by the driver while the bus movesPassenger standing beside the driver while moving · person → zone → sensor → alert+ 1 other field
6. Ramp put out for a wheelchair user at the stopRamp put out for a wheelchair user · person + custom detector → rule → report+ 1 other field
7. Stop crowded while the next bus is 15 min awayPeople waiting and no transport: send more · person + vehicle → zone → rule → alert+ 1 other field
8. Pedestrian in front of the bus as it pulls awayPerson in a vehicle’s blind spot as it moves off · sensor + person → zone → alert+ 2 other fields
9. Passenger asleep on the back seat at the depotNobody left inside when it is locked up · person + sensor → zone → counter → alert+ 2 other fields
10. Seats slashed on the busVandalism caught as it happens · pose → zone → rule → alert+ 2 other fields
11. Buses back at the depot on time, by plateEach vehicle’s time out and back, by plate · plate OCR → line → timer → report+ 2 other fields
12. Bus guided close to the kerb at a level-boarding stopVehicle guided onto its stop mark · vehicle → tracker → measure → webhook+ 2 other fields
13. Driver attacked in the cabFight or violence breaking out · pose → tracker → rule → alert+ 3 other fields
14. Every bus through the wash before it parks for the nightVehicle skipping a stop it must make: wash, check or scan · vehicle → zone → sequence → alert+ 3 other fields
15. Bus interior cleaned before the first runCleaned properly: nothing missed, no streaks or spots · custom detector → classify → review+ 3 other fields
16. Cash taken by the driver with no ticket printedTill exceptions: no scan, no sale, cash off the books · pose + sensor → compare → review+ 4 other fields
17. Cars passing the bus while its stop arm is outRed light, stop sign or stop arm run · classify + vehicle → line → snapshot+ 4 other fields
18. Adverts on bus-stop screens logged as playedAd screens showing the booked content, logged · classify → schedule → report+ 4 other fields
19. Litter and lost property left on the bus at the depotObject left behind by its owner · any-object (YOLOE) → timer → cross-camera → alert+ 6 other fields
20. Flat or bald tyre on a bus leaving the depotWear parts worn out: teeth, tyres, cables, pads · custom detector → classify → report+ 6 other fields
21. Boardings against validator taps: fares not paidHeadcount against tickets and transactions · person + vehicle + sensor → counter → compare → review+ 7 other fields
22. Pickpocket on a crowded busTheft from a person: pickpocket or bag snatch · pose + tracker → proximity → review+ 7 other fields
23. Passengers boarding and alighting, counted at the doorsFootfall: people in and out, by hour · person → line → counter → report+ 7 other fields
24. Cars parked in the bus-stop baysVehicle stopped too long where time is limited · vehicle → zone → timer → alert+ 8 other fields
25. Minutes each bus stands at each stopEach vehicle’s time at each stop, and for how long · vehicle + COCO object → zone → timer → report+ 9 other fields
26. Passengers on board against the bus’s capacityHow full it is right now, against capacity · person → zone → counter → webhook+ 9 other fields
27. Passenger information screen blank at a stopLights, screens and signs dark when they should be on · classify → schedule → report+ 9 other fields
28. Buses idling at the depot before the first runEngines and equipment running when nobody needs them · motion + thermal camera → timer → alert+ 10 other fields

Show all 28

15 solutions · 1 only here

Driver monitoring

Is every driver awake, watching the road and driving safely?

Built fromzonevehiclesensormeasuretimerface IDpersontrackercustom detectorclassifyposesegmentcustom posecompare

Build this for my site

1. Drifting out of the lane without signallingsegment → measure → alert
2. Eyes closed for 2 s, yawning, or eyes off the road for 3 sDriver drowsy or distracted at the wheel · custom pose → timer → alert+ 1 other field
3. Only the assigned driver can start the vehicleface ID → compare → relay+ 1 other field
4. Same driver at the wheel for over 4.5 hoursSame driver at the wheel for too long · face ID → timer → alert+ 1 other field
5. Passenger standing beside the driver while movingperson → zone → sensor → alert+ 1 other field
6. Dashcam clip of a crash: speeds and positionsSpeeds and positions before a crash, from the video · vehicle → tracker → speed → report+ 1 other field
7. Cyclist in the blind spot while the truck turnsPerson in a vehicle’s blind spot as it moves off · sensor + person → zone → alert+ 2 other fields
8. Following too close behind the vehicle aheadFollowing or passing too close to another vehicle · vehicle → tracker → measure → alert+ 2 other fields
9. Trailer coupling checked on the cab camera before movingTrailer coupled right before it pulls away · custom detector → classify → alert+ 2 other fields
10. Phone in the driver’s hand at the wheelPhone in hand where it is not allowed · pose + COCO object → phone use → review+ 3 other fields
11. Rolling through a stop sign, from the forward cameraRed light, stop sign or stop arm run · classify + vehicle → line → snapshot+ 4 other fields
12. Driver’s seatbelt unbuckled while the vehicle movesSeatbelt or helmet not worn while driving or riding · vehicle + custom detector → rule → snapshot+ 4 other fields
13. Harsh-braking clips kept for driver coachingAny sensor alarm arrives with its video · sensor → PTZ → clip → report+ 4 other fields
14. Driver smoking in a tanker cabSmoking where a spark is dangerous · any-object (YOLOE) → zone → alert+ 5 other fields
15. Walk-round check done before the first tripSteps of a procedure done, and in the right order · pose → zone → sequence → alert+ 11 other fields

22 solutions · 2 only here

Parcel hubs & fulfilment

Did every parcel get through undamaged, and was every order packed right?

Built fromcustom detectorcompareclassifysegmentrulemeasurebarcodecountertrackerlinemotionposespeedperson

Build this for my site

1. Box too big for what is in itsegment → measure → review
2. Fragile items packed with padding on every sidecustom detector → rule → review
3. Parcels thrown instead of placedGoods thrown instead of placed · pose + custom detector → speed → review+ 1 other field
4. Walking distance per order on the picker’s routeperson → tracker → measure → report+ 1 other field
5. Product photos checked before listing: background, angle, blurPhoto set checked: every angle, sharp, right background · classify → rule → review+ 1 other field
6. Courier’s doorstep photo checked for the right addressPhoto evidence reused, or taken in the wrong place · classify → compare → review+ 1 other field
7. Parcel dimensions measured for billingParcel and pallet dimensions measured for billing · segment → measure → webhook+ 1 other field
8. Heavy parcels loaded on top of fragile ones in the cageHeavy goods stacked on fragile ones · custom detector → classify → rule → alert+ 1 other field
9. Van loaded with the right cages for its routeLoad put on the wrong vehicle or the wrong pile · custom detector + plate OCR → compare → alert+ 2 other fields
10. Packing filmed and attached to every orderJob or delivery filmed and tied to its order · barcode + sensor → clip → compare → review+ 2 other fields
11. Cages and roll containers counted out and backReturnable cages, crates and batteries counted out and back · custom detector → counter → compare → report+ 2 other fields
12. Each parcel followed through the hub, camera to cameraEach pallet or parcel followed from the dock to its place · custom detector + barcode → cross-camera → webhook+ 2 other fields
13. Parcels per hour into each sorter chuteOutput counted off the line, per hour and shift · custom detector → line → counter → report+ 3 other fields
14. Parcels thrown over the hub fence at nightGoods thrown over the fence to someone outside · motion → tracker → line → alert+ 4 other fields
15. Batteries and liquids flagged in parcel X-raysX-ray image checked for hidden or dangerous goods · custom detector → classify → review+ 4 other fields
16. Parcel jammed at a merge on the sorterLine flow fault: tear, jam, spill or fallen item · segment + motion → rule → relay+ 4 other fields
17. Crushed or torn boxes at the inbound scanDamage at handover: new since the last check-in · custom detector → compare → snapshot → report+ 5 other fields
18. Parcel leaking liquid on the beltLeak from a pipe, roof, tank or drum · segment → trend → alert+ 7 other fields
19. Right items picked and counted into the box against the orderEverything there: right parts, right count · custom detector → counter → compare → relay+ 10 other fields
20. Label unreadable or missing before the sorterLabel and code present, straight and right · OCR + barcode → compare → relay+ 11 other fields
21. Returns graded from photos: new, used or damagedGraded by size and colour, then sorted · custom detector → classify → relay+ 12 other fields
22. Battery smoking in a parcel on the sorterFlame or smoke spotted early, indoors or on the horizon · custom detector + thermal camera → PTZ → alert+ 12 other fields

Show all 22

19 solutions · 1 only here

Oil, gas & pipelines

Is anything leaking, burning or unguarded along the line?

Built fromzonecustom detectorsegmentrulepersonmeasurecomparetrendany-object (YOLOE)colourmotionproximitythermal cameraclassify

Build this for my site

1. Flare stack flame gone outcustom detector → rule → alert
2. Digger working over the pipeline routeDigger working over a buried pipe or cable · any-object (YOLOE) → zone → PTZ → alert+ 1 other field
3. Hot work on the plant with no fire watch beside itHot work with no fire watch nearby · custom detector + person → proximity → alert+ 1 other field
4. Gas plume on an optical gas-imaging cameraGas plume seen on an optical gas-imaging camera · thermal camera → segment → alert+ 1 other field
5. Valve open or shut, checked against the control roomValve, gate and breaker positions read and checked · classify → measure → compare → report+ 2 other fields
6. Loading arm connected before the pump startsWrong hose, arm or nozzle on the tank before it is filled · OCR + custom detector → compare → alert+ 2 other fields
7. Welder in a pipeline trench with no ladder outTrench unsafe: no shoring, spoil at the edge, someone inside · person + custom detector → zone → rule → alert+ 3 other fields
8. Floating tank roof tilted after a stormKnocked out of line: antennas, trackers, tank roofs · custom detector → measure → compare → alert+ 3 other fields
9. Oil spreading on the bund floor, or a sheen downstreamOil spilled on the ground or the water · colour + segment → rule → alert+ 3 other fields
10. Crew on the plant stairs not holding the railPeople on the stairs not holding the handrail · pose → zone → rule → report+ 4 other fields
11. Permit-to-work briefing held before the job startsSafety briefing held, and who attended · face ID → zone → schedule → report+ 5 other fields
12. Compressor vibration read from video on the skidVibration measured from video, before a bearing fails · motion → measure → trend → alert+ 5 other fields
13. Cigarette lit inside the hazardous areaSmoking where a spark is dangerous · any-object (YOLOE) → zone → alert+ 5 other fields
14. Black smoke from the flare: poor combustionDust or smoke over the limit · segment → measure → alert+ 5 other fields
15. Steam or vapour escaping from a flangeLeak from a pipe, roof, tank or drum · segment → trend → alert+ 7 other fields
16. Corrosion on pipe racks, from the inspection flightStructure wearing out: cracks, corrosion, loose parts · custom detector + segment → trend → report+ 9 other fields
17. Pumpjack stopped at a remote wellMachine running, idle or stopped, minute by minute · motion + colour → zone → timer → report+ 10 other fields
18. Someone at a remote wellhead at nightIntrusion: someone inside the fence or a closed zone · person → zone → PTZ → alert+ 14 other fields
19. Flame-resistant coveralls on everyone inside the plant fenceProtective kit worn where the job needs it · person + custom detector → zone → alert+ 20 other fields

Show all 19

24 solutions · 1 only here

Power & water utilities

Is anyone inside the fence at a site nobody staffs?

Built fromcustom detectortrendzonemeasurepersonsegmentrulemotiondrone videoany-object (YOLOE)OCRtrackercoloursensor

Build this for my site

1. Conductor sag measured on a hot daycustom detector → measure → trend → alert
2. Bird nests on pylons, from the line patrol videoBird nests on pylons and masts · drone video → custom detector → report+ 1 other field
3. Digger working over buried power cablesDigger working over a buried pipe or cable · any-object (YOLOE) → zone → PTZ → alert+ 1 other field
4. Debris on the intake screen at the water worksFloating debris at an intake or boom · segment → measure → alert+ 1 other field
5. Crane at the substation lifting with no mats under its outriggersMobile crane lifting without its outriggers out on mats · custom detector → rule → alert+ 2 other fields
6. Customer meters read from the reader’s photoUtility meters read by camera, digits or spinning disc · OCR + motion → trend → report+ 2 other fields
7. Tree branches growing too close to the power lineTrees and shrubs growing into lines and panels · drone video → segment → measure → report+ 2 other fields
8. Work started on a line with no earthing clamps onEarth clamps off during loading or live work · custom detector → rule → alert+ 2 other fields
9. Crew in a cable trench with spoil heaped on the edgeTrench unsafe: no shoring, spoil at the edge, someone inside · person + custom detector → zone → rule → alert+ 3 other fields
10. Activity at a pump station outside its usual patternSomething unusual for this camera at this hour · motion + tracker → trend → alert+ 3 other fields
11. Foam building on an aeration basinWater turning cloudy, green or foamy · colour → trend → alert+ 3 other fields
12. Illegal connection: cable run from a pole to a houseWater, power, sand or timber taken without a permit · any-object (YOLOE) + person → zone → snapshot+ 3 other fields
13. Meter and sensor readings beside the videoAny sensor alarm arrives with its video · sensor → PTZ → clip → report+ 4 other fields
14. Crane working inside the clearance of a live lineBoom or tipper raised near an overhead power line · custom detector → zone → measure → alert+ 5 other fields
15. Hot joints on busbars, seen by a thermal cameraHot spots on equipment from a thermal camera · thermal camera → heatmap → alert+ 5 other fields
16. Pump vibration read from video at unstaffed stationsVibration measured from video, before a bearing fails · motion → measure → trend → alert+ 5 other fields
17. Lone worker motionless in a pump roomFall or collapse: someone down and not getting up · pose → person down → alert + relay+ 7 other fields
18. Hatch left open on a drinking-water tankDoor held open or forced · door event + person → timer → alert+ 7 other fields
19. Oil weeping from a transformerLeak from a pipe, roof, tank or drum · segment → trend → alert+ 7 other fields
20. Transformer oil level in the sight glassBin, tank or bag nearly full or nearly empty · segment → measure → alert+ 9 other fields
21. Cracked insulators and flashover marksStructure wearing out: cracks, corrosion, loose parts · custom detector + segment → trend → report+ 9 other fields
22. Anyone inside the live-equipment clearance at a substationPerson inside a hazard zone while it is live · person → zone → schedule → alert + relay+ 14 other fields
23. Anyone inside the fence at an unstaffed substationIntrusion: someone inside the fence or a closed zone · person → zone → PTZ → alert+ 14 other fields
24. Insulated gloves and arc-flash hood at the switchgearProtective kit worn where the job needs it · person + custom detector → zone → alert+ 20 other fields

Show all 24

18 solutions

Solar & wind farms

Which panels are dirty, cracked or stolen, and is anyone inside the fence?

Built fromcustom detectorzonemeasurepersonsegmenttrendcomparedrone videothermal cameramotionscheduletimerclassifytile

Build this for my site

1. Eagle approaching a turbine: rotor slowedBirds heading into aircraft or turbine blades · tile → animal → proximity → relay+ 1 other field
2. Gap cut in the perimeter fenceFence cut or dug under · custom detector → compare → alert+ 2 other fields
3. Grass and shrubs shading the lowest rowTrees and shrubs growing into lines and panels · drone video → segment → measure → report+ 2 other fields
4. Tracker rows stuck at the wrong angleKnocked out of line: antennas, trackers, tank roofs · custom detector → measure → compare → alert+ 3 other fields
5. Ice building on the turbine bladesIce or snow building up where it can fall or overload · custom detector → measure → alert+ 3 other fields
6. Cracked panel glass after hailStorm and hail damage surveyed from the air · drone video → segment → measure → report+ 3 other fields
7. Panels counted row by row from the airStock counted where it stands, against the system · custom detector → zone → counter → report+ 5 other fields
8. Hot spots on panels from a thermal drone flightHot spots on equipment from a thermal camera · thermal camera → heatmap → alert+ 5 other fields
9. Tower sway and nacelle vibration read from videoVibration measured from video, before a bearing fails · motion → measure → trend → alert+ 5 other fields
10. Panel cleaners working through the afternoon heatToo long in the heat or the cold without a break · person → zone → schedule + timer → alert+ 6 other fields
11. Dust or snow covering the panel rowsBuild-up that needs cleaning: grease, lint, dust, ice · classify → trend → report+ 6 other fields
12. Panels carried towards the fenceValuable or equipment taken from its place · person + custom detector → zone → rule → alert+ 7 other fields
13. Blade damage from a drone inspectionStructure wearing out: cracks, corrosion, loose parts · custom detector + segment → trend → report+ 9 other fields
14. Cleaning robot stuck on a rowMachine running, idle or stopped, minute by minute · motion + colour → zone → timer → report+ 10 other fields
15. Grass fire spreading inside the solar farmFlame or smoke spotted early, indoors or on the horizon · custom detector + thermal camera → PTZ → alert+ 12 other fields
16. Anyone under a turbine while its blades shed icePerson inside a hazard zone while it is live · person → zone → schedule → alert + relay+ 14 other fields
17. Anyone inside the solar farm fence at nightIntrusion: someone inside the fence or a closed zone · person → zone → PTZ → alert+ 14 other fields
18. Cracked cells in electroluminescence images of the panelsSurface defects: scratches, cracks, stains and holes · custom detector → classify → relay+ 14 other fields

14 solutions · 1 only here

Automotive plants

Is every car built right, and was every bolt tightened?

Built fromcustom detectorcomparesegmentmeasurezoneclassifyrulecoloursensorpersonOCRcounterposesequence

Build this for my site

1. Water inside after the shower test, or oil dripping underneathWater in or oil out at the end of the line · custom detector → rule → review
2. Paint shade matched between the bumper and the bodyColour and grain matched to the approved sample · colour → compare → report+ 2 other fields
3. Seat or panel fitted the wrong way round on the linePart loaded the wrong way round · custom detector → classify → relay+ 2 other fields
4. Coolant and washer fluid filled to the markFilled to the line, unit by unit · custom detector → segment → measure → relay+ 3 other fields
5. Tools and parts not back in their 5S placesChanged from its reference photo: 5S, cabling, layout · custom detector → compare → alert+ 3 other fields
6. Windscreen glue bead unbroken, every spot weld thereJoints, seams and beads complete · custom detector + segment → measure → review+ 4 other fields
7. Andon pulls per station, each with its clipAny sensor alarm arrives with its video · sensor → PTZ → clip → report+ 4 other fields
8. Someone inside a robot cell while it runsMachine stopped when someone steps into its danger zone · person → zone → relay+ 5 other fields
9. Panel gaps and flush measured around the doorsSize and position measured against the drawing · segment → measure → compare → relay+ 7 other fields
10. VIN read and matched to the build orderUnit numbers read and logged: containers, wagons, VINs, serials · custom detector → OCR → webhook+ 8 other fields
11. Right trim and wheels, and no clip or bolt missingEverything there: right parts, right count · custom detector → counter → compare → relay+ 10 other fields
12. Torque tool applied to every wheel nutSteps of a procedure done, and in the right order · pose → zone → sequence → alert+ 11 other fields
13. AGV route blocked by a pallet or a personSomething blocking a way or kit that must stay clear · tile → custom detector → zone → timer → alert+ 12 other fields
14. Paint runs, orange peel, and wrinkled seat coversSurface defects: scratches, cracks, stains and holes · custom detector → classify → relay+ 14 other fields

13 solutions · 3 only here

Electronics & appliances

Is every board soldered right, and every unit tested before it ships?

Built fromcustom detectorcomparerulesegmentmeasureclassifyOCRzonecolourschedulecounterbarcodeperson

Build this for my site

1. Conformal coating coverage under UV lightCoating coverage checked under UV light · segment → measure → relay
2. Every LED lights in the right colour, no dead pixelsLights and screens tested: right colour, no dead pixels · colour + custom detector → compare → relay
3. Protective film left on the screen at packingProtective film left on at packing · custom detector → rule → review
4. Solder fume extractor pushed away from the benchDust or fume extraction not connected · custom detector → rule → alert+ 1 other field
5. Chip or connector placed the wrong way roundPart loaded the wrong way round · custom detector → classify → relay+ 2 other fields
6. Soldering irons left hot on empty benchesHeater, burner or iron left on after closing · custom detector → schedule → alert+ 3 other fields
7. Solder bridges, dry joints, brazes and door gasketsJoints, seams and beads complete · custom detector + segment → measure → review+ 4 other fields
8. Serial number paired with the unit’s test resultUnit numbers read and logged: containers, wagons, VINs, serials · custom detector → OCR → webhook+ 8 other fields
9. Component reel running out on the placement machineRunning empty: shelf, bin, tray or feeder to refill · custom detector → zone → rule → alert+ 9 other fields
10. Components missing or unseated, pins bent, a screw not drivenEverything there: right parts, right count · custom detector → counter → compare → relay+ 10 other fields
11. Carton label matches the model and serial insideLabel and code present, straight and right · OCR + barcode → compare → relay+ 11 other fields
12. Scratches and particles on wafers under the microscope cameraSurface defects: scratches, cracks, stains and holes · custom detector → classify → relay+ 14 other fields
13. Wrist strap worn at the ESD benchProtective kit worn where the job needs it · person + custom detector → zone → alert+ 20 other fields

13 solutions · 3 only here

Steel & metals

Is anyone near the molten metal, and is every bar and coil right?

Built fromcustom detectorclassifythermal camerasegmentproximitymeasurepersoncomparetrackerany-object (YOLOE)speedOCRcounterzone

Build this for my site

1. Molten metal splashing outside the pour zonethermal camera → segment → alert
2. Blocked tuyere seen through the peephole camerathermal camera → classify → alert
3. Slag running into the ladle during tappingthermal camera → classify → relay
4. Overhead cranes in the melt shop closing on each otherCrane jibs or booms swinging into each other · custom detector → tracker → proximity → alert+ 2 other fields
5. Pour stopped when the mould is fullFilled to the line, unit by unit · custom detector → segment → measure → relay+ 3 other fields
6. Person in the path of a moving ladleNear miss between a person and a moving machine · person + any-object (YOLOE) → proximity → speed → alert+ 6 other fields
7. Coil diameter and telescoping measuredSize and position measured against the drawing · segment → measure → compare → relay+ 7 other fields
8. Sealed containers hidden in the scrap before it hits the furnaceForeign objects in the product or the feed · custom detector → classify → relay+ 7 other fields
9. Heat numbers on billets read at the cooling bedUnit numbers read and logged: containers, wagons, VINs, serials · custom detector → OCR → webhook+ 8 other fields
10. Rebars counted end-on in each bundleEverything there: right parts, right count · custom detector → counter → compare → relay+ 10 other fields
11. Scrap truck load graded before it tipsGraded by size and colour, then sorted · custom detector → classify → relay+ 12 other fields
12. Cracks and scale on hot slabs, porosity on castingsSurface defects: scratches, cracks, stains and holes · custom detector → classify → relay+ 14 other fields
13. Aluminised suit on at the tapping floorProtective kit worn where the job needs it · person + custom detector → zone → alert+ 20 other fields

17 solutions · 2 only here

Chemicals & fertiliser

Is every tank, drum and worker safe, and would you know first if something leaked?

Built fromcustom detectorrulesegmentpersonzoneOCRsensorcomparemeasureclassifytimerthermal cameraproximityface ID

Build this for my site

1. Acid carboys moved without a spill traycustom detector → rule → alert
2. Wind direction read off the windsock during a gas alarmclassify → rule → alert
3. Someone under the safety shower: help sentSomeone at the safety shower or eyewash: help sent · person → zone → timer → alert+ 1 other field
4. Vapour cloud seen on a gas-imaging cameraGas plume seen on an optical gas-imaging camera · thermal camera → segment → alert+ 1 other field
5. Drums of incompatible chemicals stored side by sideThings that must be kept apart, stored together · OCR + custom detector → proximity → alert+ 1 other field
6. Roll-call at the assembly point when the gas alarm soundsRoll-call: who is still inside, and who got out · sensor + face ID → cross-camera → report+ 2 other fields
7. Tanker hose connected to the wrong tank inletWrong hose, arm or nozzle on the tank before it is filled · OCR + custom detector → compare → alert+ 2 other fields
8. Road tanker filling with no earth clamp onEarth clamps off during loading or live work · custom detector → rule → alert+ 2 other fields
9. Worker in a confined space with no attendant at the hatchNobody alone where a second person is required · person → post + counter → rule → alert+ 4 other fields
10. Staff on the tank-farm stairs not holding the railPeople on the stairs not holding the handrail · pose → zone → rule → report+ 4 other fields
11. Gas detector alarm, with the nearest camera turned onto itAny sensor alarm arrives with its video · sensor → PTZ → clip → report+ 4 other fields
12. Dust cloud when a sack is emptied into the mixerDust or smoke over the limit · segment → measure → alert+ 5 other fields
13. Gas cylinders standing unchained in the storeGas cylinders standing without a chain or cage · custom detector → rule → alert+ 5 other fields
14. Salt crust on a pipe joint, or a drum bulging or leakingLeak from a pipe, roof, tank or drum · segment → trend → alert+ 7 other fields
15. Tank filling past its safe level during unloadingBin, tank or bag nearly full or nearly empty · segment → measure → alert+ 9 other fields
16. Drum labels match the contents listLabel and code present, straight and right · OCR + barcode → compare → relay+ 11 other fields
17. Face shield and chemical suit at the acid unloading bayProtective kit worn where the job needs it · person + custom detector → zone → alert+ 20 other fields

15 solutions · 1 only here

Cement & building materials

Is every bag counted onto the truck, and is the kiln running right?

Built fromcustom detectorsegmentmeasureclassifythermal cameratrendvehiclerulemotionzonedrone videoSAMheatmapline

Build this for my site

1. Flame shape inside the kiln, from the burner camerathermal camera → segment → trend → alert
2. Oversize lumps on the crusher feedsegment → measure → relay+ 1 other field
3. Clinker and aggregate stockpiles measured from the airStockpile volume from a drone flight · drone video → SAM → measure → report+ 2 other fields
4. Loaded truck leaving without its tarpaulinLoad unsecured, or fallen off on the way · vehicle + custom detector → rule → alert+ 4 other fields
5. Material spilling off the conveyor, or a blocked chuteLine flow fault: tear, jam, spill or fallen item · segment + motion → rule → relay+ 4 other fields
6. Hot spots on the kiln shellHot spots on equipment from a thermal camera · thermal camera → heatmap → alert+ 5 other fields
7. Kiln drive and fan vibration read from videoVibration measured from video, before a bearing fails · motion → measure → trend → alert+ 5 other fields
8. Dust from the stack above the permitted opacityDust or smoke over the limit · segment → measure → alert+ 5 other fields
9. Torn bags on the packing linePacks closed and intact: caps, flaps, bags, straps · custom detector → classify → relay+ 6 other fields
10. Cement bags counted onto each truckGoods counted onto or off each vehicle · custom detector → line → counter → report+ 6 other fields
11. Concrete blocks off-size on the curing rackSize and position measured against the drawing · segment → measure → compare → relay+ 7 other fields
12. Bulk tankers’ time from the gate to loading and outEach vehicle’s time at each stop, and for how long · vehicle + COCO object → zone → timer → report+ 9 other fields
13. Ceramic tiles sorted by shade and chipsGraded by size and colour, then sorted · custom detector → classify → relay+ 12 other fields
14. Cracks in blocks and pipes, bubbles in float glassSurface defects: scratches, cracks, stains and holes · custom detector → classify → relay+ 14 other fields
15. Dust mask on at the packing and bagging lineProtective kit worn where the job needs it · person + custom detector → zone → alert+ 20 other fields

12 solutions

Beverages & bottling

Is every bottle filled, capped and labelled right?

Built fromcustom detectorcomparesegmentclassifycountermeasurecolourlinemotionruleOCRbarcode

Build this for my site

1. Cap colour wrong for the flavour on the lineWrong product mixed into the batch · colour + custom detector → compare → relay+ 1 other field
2. Our brand’s share of a shop’s cooler, from the rep’s photoShelf set out as the plan says, and the brand’s share of it · custom detector → compare → report+ 1 other field
3. Bottles kicked off the line, counted per hourRejects counted into the scrap bin, machine by machine · custom detector → line → counter → report+ 2 other fields
4. Fill level of every bottle on the lineFilled to the line, unit by unit · custom detector → segment → measure → relay+ 3 other fields
5. Can seams checked for a proper double seamJoints, seams and beads complete · custom detector + segment → measure → review+ 4 other fields
6. Bottles knocked over before the fillerLine flow fault: tear, jam, spill or fallen item · segment + motion → rule → relay+ 4 other fields
7. Kegs returned dented or leakingDamage at handover: new since the last check-in · custom detector → compare → snapshot → report+ 5 other fields
8. Cap missing, skewed or not screwed downPacks closed and intact: caps, flaps, bags, straps · custom detector → classify → relay+ 6 other fields
9. Glass or foreign objects in bottles before fillingForeign objects in the product or the feed · custom detector → classify → relay+ 7 other fields
10. Crates leaving with an empty slotEverything there: right parts, right count · custom detector → counter → compare → relay+ 10 other fields
11. Label present and straightLabel and code present, straight and right · OCR + barcode → compare → relay+ 11 other fields
12. PET preforms with defects before blowingSurface defects: scratches, cracks, stains and holes · custom detector → classify → relay+ 14 other fields

13 solutions

Meat & poultry processing

Is every carcass clean, every knife hand gloved and every bird counted?

Built fromcustom detectorzoneclassifytimerpersonsequenceposecolouranimalsegmentmeasurecomparelinecounter

Build this for my site

1. Worker crossing from the raw side to the cooked sideCrossing from a dirty zone into a clean one · colour → zone → alert+ 1 other field
2. Animals held in the lairage for over 12 hoursAnimals kept waiting in a pen too long · animal → zone → timer → alert+ 1 other field
3. Portion cuts sized against the orderPortion size on every plate or pack · segment → measure → compare → review+ 2 other fields
4. Bruises and broken wings on birdsInjuries on animals: bruises, lesions, pecking · custom detector → classify → report+ 2 other fields
5. Birds per hour on the shackle line, empty shackles flaggedOutput counted off the line, per hour and shift · custom detector → line → counter → report+ 3 other fields
6. Carcasses into the chiller within 45 minutesChilled goods left out of the cold too long · custom detector → zone → timer → alert+ 3 other fields
7. Boots through the wash before the production floorHands washed or boots dipped before going in · person → zone → sequence → alert+ 4 other fields
8. Hand too close to the band-saw bladeHands too close to a blade, needle or rollers · pose + custom detector → rule → review+ 4 other fields
9. Bone fragments or plastic on the trim beltForeign objects in the product or the feed · custom detector → classify → relay+ 7 other fields
10. Knife dipped in the steriliser between carcassesSteps of a procedure done, and in the right order · pose → zone → sequence → alert+ 11 other fields
11. Cuts sorted, fat cover and hides gradedGraded by size and colour, then sorted · custom detector → classify → relay+ 12 other fields
12. Faecal or bile spots on carcassesSurface defects: scratches, cracks, stains and holes · custom detector → classify → relay+ 14 other fields
13. Chainmail glove on the hand holding the meatProtective kit worn where the job needs it · person + custom detector → zone → alert+ 20 other fields

17 solutions · 2 only here

Packhouses & cold stores

Is every fruit graded right, every box full and every cold-room door shut?

Built fromcustom detectorclassifycounterpersonzonetimertrendcolourdoor eventsegmentmeasuresensormotionheatmap

Build this for my site

1. Frost on cartons: goods thawed and frozen againcustom detector → classify → review
2. Sprouting and rot in onion and potato storesSprouting and rot spreading in a store · custom detector → trend → alert
3. Apricots dried evenly on the drying racksBaked, dried or risen to the right point · colour + segment → measure → relay+ 1 other field
4. Person still inside a freezer after the door shutsNobody left inside when it is locked up · person + sensor → zone → counter → alert+ 2 other fields
5. Cold-room door openings per shiftDoor openings counted where every opening costs · door event → counter → report+ 2 other fields
6. Banana ripening stage by peel colourRipe and ready to pick, by colour and size · colour → classify → report+ 2 other fields
7. Pallets left warming in the dock airlockChilled goods left out of the cold too long · custom detector → zone → timer → alert+ 3 other fields
8. Rodents in the onion and potato storePests and stray animals where food or stock is kept · motion → custom detector → heatmap → alert+ 3 other fields
9. Boxes packed per packer for piece-rate payOutput per worker for piece-rate pay · custom detector → line → counter → payroll+ 4 other fields
10. Newest pallets shipped before older ones in the cold storeNewest stock picked before the oldest · OCR → sequence → review+ 4 other fields
11. Time each worker spends inside the freezerToo long in the heat or the cold without a break · person → zone → schedule + timer → alert+ 6 other fields
12. Ice building up on the evaporatorBuild-up that needs cleaning: grease, lint, dust, ice · classify → trend → report+ 6 other fields
13. Cold-room door left open, the room warmingDoor held open or forced · door event + person → timer → alert+ 7 other fields
14. Stones and sticks among the fruit on the lineForeign objects in the product or the feed · custom detector → classify → relay+ 7 other fields
15. Fruit per tray matched to the size gradeEverything there: right parts, right count · custom detector → counter → compare → relay+ 10 other fields
16. Fruit graded by size and colour, stalks and stems sortedGraded by size and colour, then sorted · custom detector → classify → relay+ 12 other fields
17. Bruises and rot on each fruitSurface defects: scratches, cracks, stains and holes · custom detector → classify → relay+ 14 other fields

22 solutions · 3 only here

Orchards & field crops

How is each field growing, and where do the weeds, pests and dry patches start?

Built fromcustom detectorsegmentcountertilezonedrone videotrendtimermeasurepersonthermal cameraclassifycolourheatmap

Build this for my site

1. Spray drifting over the field edge onto a road or a housesegment → zone → alert
2. Weeds mapped between the rowsdrone video → segment → heatmap → report
3. Grain lost behind the combinecustom detector → counter → alert
4. Fruit counted per tree for a yield forecastFruit counted on the plant for the harvest plan · RF-DETR → tile → counter → report+ 1 other field
5. Water reached the tail end of every furrowWater reaching every row: dry spots found · thermal camera + segment → timer → report+ 1 other field
6. Crop height and cover, field by fieldPlant height and growth, day by day · segment → measure → trend → report+ 1 other field
7. Moths counted on the orchard’s pheromone trapsInsects counted on sticky and pheromone traps · tile → custom detector → counter → trend → report+ 1 other field
8. Bees working the orchard at blossomBee visits counted at the hive or the blossom · tile → custom detector → counter → report+ 1 other field
9. Locust swarm arriving over the fieldstile → custom detector → trend → alert+ 1 other field
10. Area harvested per day, from a drone passWork progress photographed and measured against the plan · drone video → segment → compare → report+ 2 other fields
11. Leaf disease spotted early: rust, blight, mildewPlant disease and pest damage spotted early · custom detector + tile → classify → report+ 2 other fields
12. Harvest date set from fruit colour on the treeRipe and ready to pick, by colour and size · colour → classify → report+ 2 other fields
13. Canopy size and missing trees, row by rowPlants that came up counted, and the gaps found · custom detector + tile → counter → report+ 2 other fields
14. Erosion gullies cut by heavy raindrone video → segment → trend → report+ 2 other fields
15. Hail net torn over an orchardStorm and hail damage surveyed from the air · drone video → segment → measure → report+ 3 other fields
16. Worker inside a grain bin with nobody at the hatchNobody alone where a second person is required · person → post + counter → rule → alert+ 4 other fields
17. Crates picked per picker at the orchard collection pointOutput per worker for piece-rate pay · custom detector → line → counter → payroll+ 4 other fields
18. Sprayer boom folding up under a power lineBoom or tipper raised near an overhead power line · custom detector → zone → measure → alert+ 5 other fields
19. Pickers in the field through the midday heat with no shade breakToo long in the heat or the cold without a break · person → zone → schedule + timer → alert+ 6 other fields
20. Irrigation pivot stopped mid-fieldMachine running, idle or stopped, minute by minute · motion + colour → zone → timer → report+ 10 other fields
21. Stubble or field fire spotted from the farm mastFlame or smoke spotted early, indoors or on the horizon · custom detector + thermal camera → PTZ → alert+ 12 other fields
22. People in the orchard at night at harvestIntrusion: someone inside the fence or a closed zone · person → zone → PTZ → alert+ 14 other fields

Show all 22

12 solutions

Cotton & ginning

How much cotton came in, how clean is it, and is any of it smouldering?

Built fromcustom detectorclassifyplate OCRcomparezonesegmentsensorrulelinecounterany-object (YOLOE)trendOCRthermal camera

Build this for my site

1. Seed cotton piles left uncovered with rain forecastLeft uncovered when it must be covered · segment + sensor → rule → alert+ 1 other field
2. Truck tipping on the pile of the wrong gradeLoad put on the wrong vehicle or the wrong pile · custom detector + plate OCR → compare → alert+ 2 other fields
3. Bales leaving the warehouse without a dispatch orderGoods or cars leaving without a dispatch order · custom detector + plate OCR → line → compare → alert+ 2 other fields
4. Weighbridge weight tied to the farmer by the truck’s plateNumber plate tied to the paperwork · plate OCR → compare → webhook+ 3 other fields
5. Bales counted in the yard against the ledgerStock counted where it stands, against the system · custom detector → zone → counter → report+ 5 other fields
6. Smoking beside the bales in the gin yardSmoking where a spark is dangerous · any-object (YOLOE) → zone → alert+ 5 other fields
7. Straps on every bale before it leaves the pressPacks closed and intact: caps, flaps, bags, straps · custom detector → classify → relay+ 6 other fields
8. Lint and dust building up on the gin standsBuild-up that needs cleaning: grease, lint, dust, ice · classify → trend → report+ 6 other fields
9. Plastic and rags in the seed cotton on the feed beltForeign objects in the product or the feed · custom detector → classify → relay+ 7 other fields
10. Bale tag read and matched to its weightUnit numbers read and logged: containers, wagons, VINs, serials · custom detector → OCR → webhook+ 8 other fields
11. Seed cotton and lint graded by colour and trashGraded by size and colour, then sorted · custom detector → classify → relay+ 12 other fields
12. Smoke from a cotton bale before it flamesFlame or smoke spotted early, indoors or on the horizon · custom detector + thermal camera → PTZ → alert+ 12 other fields

14 solutions

Greenhouses

How is each row growing, and where are the pests?

Built fromcustom detectortilecounterclassifysegmentmeasuretrendscheduleRF-DETRthermal cameratimersensorrulecolour

Build this for my site

1. Tomatoes counted by ripeness for the harvest planFruit counted on the plant for the harvest plan · RF-DETR → tile → counter → report+ 1 other field
2. Blocked drippers: dry spots in the substrateWater reaching every row: dry spots found · thermal camera + segment → timer → report+ 1 other field
3. Plant height and leaf growth per dayPlant height and growth, day by day · segment → measure → trend → report+ 1 other field
4. Whiteflies counted on the sticky trapsInsects counted on sticky and pheromone traps · tile → custom detector → counter → trend → report+ 1 other field
5. Bumblebee visits counted at the hive doorBee visits counted at the hive or the blossom · tile → custom detector → counter → report+ 1 other field
6. Screens and vents open or shut against the climate planWindow or vent open against the heating, cooling or climate plan · classify + sensor → rule → alert+ 2 other fields
7. Blossom-end rot, mildew and blight on the tomato rowsPlant disease and pest damage spotted early · custom detector + tile → classify → report+ 2 other fields
8. Mushroom caps ready to pick, by sizeRipe and ready to pick, by colour and size · colour → classify → report+ 2 other fields
9. Seedlings germinated per trayPlants that came up counted, and the gaps found · custom detector + tile → counter → report+ 2 other fields
10. Snow load on the glasshouse roofIce or snow building up where it can fall or overload · custom detector → measure → alert+ 3 other fields
11. Crates harvested per picker per rowOutput per worker for piece-rate pay · custom detector → line → counter → payroll+ 4 other fields
12. Broken glass pane in the roofBroken fittings found: glass, seats, nets, racking · custom detector → compare → report+ 8 other fields
13. LED grow lights out in a vertical-farm rackLights, screens and signs dark when they should be on · classify → schedule → report+ 9 other fields
14. Staff back in a row before the spray re-entry timePerson inside a hazard zone while it is live · person → zone → schedule → alert + relay+ 14 other fields

15 solutions · 1 only here

Poultry & egg farms

Are the birds healthy, fed and comfortable, and is every egg collected?

Built fromcustom detectorzonecountercustom posetrendheatmapruleclassifylinemotionsegmenttrackerany-object (YOLOE)schedule

Build this for my site

1. Floor eggs laid outside the nestscustom detector → counter → report
2. Broilers walking badly, gait scored across the flockLameness spotted from how an animal walks · custom pose → tracker → trend → alert+ 1 other field
3. Dead birds on the house floor, found each morningDead animals found each morning · custom detector → heatmap → alert+ 1 other field
4. Fox at the free-range fence at dawnPredators near the stock · any-object (YOLOE) → zone → schedule → alert+ 2 other fields
5. Birds huddling from cold or panting in the heatAnimals in distress: rolling, panting, gasping · custom pose + custom detector → rule → alert+ 2 other fields
6. Feather pecking outbreaks in a flockInjuries on animals: bruises, lesions, pecking · custom detector → classify → report+ 2 other fields
7. Eggs counted on the collection belt, per houseOutput counted off the line, per hour and shift · custom detector → line → counter → report+ 3 other fields
8. Birds counted into the house at placementAnimal headcount: all present, and through each gate · animal + custom detector → line → counter → report+ 3 other fields
9. Wild birds inside the poultry housePests and stray animals where food or stock is kept · motion → custom detector → heatmap → alert+ 3 other fields
10. Boot dip used at the door of every houseHands washed or boots dipped before going in · person → zone → sequence → alert+ 4 other fields
11. Wet litter under a leaking drinker lineLeak from a pipe, roof, tank or drum · segment → trend → alert+ 7 other fields
12. Feeder pans empty along the lineRunning empty: shelf, bin, tray or feeder to refill · custom detector → zone → rule → alert+ 9 other fields
13. Feed bin outside each house nearly emptyBin, tank or bag nearly full or nearly empty · segment → measure → alert+ 9 other fields
14. Ventilation fan stopped in a full houseMachine running, idle or stopped, minute by minute · motion + colour → zone → timer → report+ 10 other fields
15. Eggs graded on the belt by size, cracks and dirtGraded by size and colour, then sorted · custom detector → classify → relay+ 12 other fields

15 solutions · 3 only here

Fish farms

Are the fish eating, growing and all still there?

Built fromcustom detectorcountertrendzonesegmentmeasurepersonclassifyheatmaptrackertimerany-object (YOLOE)schedulecustom pose

Build this for my site

1. Feed pellets sinking uneaten: feeder stoppedcustom detector → counter → relay
2. Holes in the winter ice kept open for airsegment → measure → alert
3. Sea lice counted on salmon in the cagecustom detector → counter → trend → alert
4. Fish length and weight on the underwater cameraAnimal weight, growth and condition estimated on camera · segment → measure → trend → report+ 1 other field
5. Dead fish on the bottom of the cageDead animals found each morning · custom detector → heatmap → alert+ 1 other field
6. Worker fallen from a cage walkway into the waterSomeone in trouble in the water · person → tracker → timer → alert+ 2 other fields
7. Cormorants and herons over the pondsPredators near the stock · any-object (YOLOE) → zone → schedule → alert+ 2 other fields
8. Fish gasping at the surface: oxygen running lowAnimals in distress: rolling, panting, gasping · custom pose + custom detector → rule → alert+ 2 other fields
9. Fin damage and skin lesionsInjuries on animals: bruises, lesions, pecking · custom detector → classify → report+ 2 other fields
10. Jellyfish swarm drifting towards the cagesSharks or jellyfish near swimmers or cages · drone video + custom detector → zone → alert+ 2 other fields
11. Pond water turning green with algaeWater turning cloudy, green or foamy · colour → trend → alert+ 3 other fields
12. Fingerlings counted as they are stocked into a pondAnimal headcount: all present, and through each gate · animal + custom detector → line → counter → report+ 3 other fields
13. Hole in a cage net, found before the fish escapeBroken fittings found: glass, seats, nets, racking · custom detector → compare → report+ 8 other fields
14. Fish sorted by size on the grading tableGraded by size and colour, then sorted · custom detector → classify → relay+ 12 other fields
15. Someone on the cage walkways at nightIntrusion: someone inside the fence or a closed zone · person → zone → PTZ → alert+ 14 other fields

12 solutions · 1 only here

Customs & border cargo

Is the seal intact, is the cargo what the papers say, and how long is the queue?

Built fromvehiclecomparepersonzonecustom detectorOCRclassifylinecounterrulescheduleplate OCRsequencesensor

Build this for my site

1. X-ray scan held until the driver has left the cabScanner held until the driver is out of the cab · person + vehicle → zone → rule → relay
2. Seal intact and the TIR cord through every eyeletSeal intact on every door and cover · custom detector + OCR → compare → alert+ 1 other field
3. Undercarriage photographed on the way inUnder-vehicle check on the way in · vehicle → snapshot → compare → review+ 1 other field
4. Container doors opened in the yard with no officer presentTrailer or container doors opened in the yard · classify + person → schedule → alert+ 2 other fields
5. Truck and trailer plates matched to the declarationNumber plate tied to the paperwork · plate OCR → compare → webhook+ 3 other fields
6. Trucks skipping the inspection laneVehicle skipping a stop it must make: wash, check or scan · vehicle → zone → sequence → alert+ 3 other fields
7. Hidden compartments and undeclared goods in truck X-raysX-ray image checked for hidden or dangerous goods · custom detector → classify → review+ 4 other fields
8. Radiation portal alarm, with the truck’s clipAny sensor alarm arrives with its video · sensor → PTZ → clip → report+ 4 other fields
9. Vehicle running the border barrierVehicle forcing its way through a barrier or gate · vehicle → speed → line → alert+ 5 other fields
10. Cargo unloaded counted against the manifestGoods counted onto or off each vehicle · custom detector → line → counter → report+ 6 other fields
11. Hazard placards on trucks checked against the declarationLabel and code present, straight and right · OCR + barcode → compare → relay+ 11 other fields
12. Trucks queuing at the border crossing, and the waitQueue length and wait, with a call to open another point · person + vehicle → zone → counter + timer → alert+ 15 other fields

9 solutions · 4 only here

Gauges & meters

What does every dial, display and meter on site read right now?

Built frommeasurecomparetrendOCRcustom poseclassifyrulesegmentmotioncustom detector

Build this for my site

1. One gauge drifting from the others on the same linecustom pose → compare → trend → alert
2. Gauge glass cracked or fogged, no longer readableclassify → rule → alert
3. Readings from patrol photos filled into the logbookOCR → compare → report
4. Chart recorder traces turned into numberssegment → measure → report
5. Analogue dials and digital displays read every minuteDials and displays read by camera, alarm out of range · custom pose + OCR → measure → rule → alert+ 1 other field
6. Breaker positions on a switchboardValve, gate and breaker positions read and checked · classify → measure → compare → report+ 2 other fields
7. Water, gas and electricity meters read in a basementUtility meters read by camera, digits or spinning disc · OCR + motion → trend → report+ 2 other fields
8. Rain gauge read at a remote weather postWater rising: river gauges, rain gauges, underpasses · custom detector → measure → trend → alert+ 4 other fields
9. Tank level read from the sight glassBin, tank or bag nearly full or nearly empty · segment → measure → alert+ 9 other fields

15 solutions

Drones & aerial surveys

What does the site look like from above this week, and what changed?

Built fromdrone videosegmentpersonzonecomparecustom detectorcountermeasuretrendtileSAMclassifyvehicleline

Build this for my site

1. Missing hiker spotted in drone footage of a gorgeMissing person spotted in drone footage · drone video → tile → person → alert+ 1 other field
2. Buildings put up without a permit, found against the cadastreBuilding work without a permit, found from above · drone video → segment → compare → report+ 1 other field
3. Tree cover lost since the last surveyTree cover lost since last year’s flight · drone video → segment → compare → report+ 1 other field
4. Stockpile volumes measured on a weekly flightStockpile volume from a drone flight · drone video → SAM → measure → report+ 2 other fields
5. Weekly drone survey measured against the building planWork progress photographed and measured against the plan · drone video → segment → compare → report+ 2 other fields
6. Herds counted from the air on a survey flightWildlife counted by species at camera traps · custom detector → classify → counter → report+ 2 other fields
7. Erosion scars mapped after heavy rainErosion gullies cut by heavy rain · drone video → segment → trend → report+ 2 other fields
8. Shark spotted from the beach patrol droneSharks or jellyfish near swimmers or cages · drone video + custom detector → zone → alert+ 2 other fields
9. Traffic counted at a junction from a hovering droneVehicles counted by class, in and out · vehicle → line → counter → report+ 3 other fields
10. Flood extent mapped after a stormStorm and hail damage surveyed from the air · drone video → segment → measure → report+ 3 other fields
11. Illegal sand pits found from the airWater, power, sand or timber taken without a permit · any-object (YOLOE) + person → zone → snapshot+ 3 other fields
12. Heat escaping through roofs, from a thermal flightHot spots on equipment from a thermal camera · thermal camera → heatmap → alert+ 5 other fields
13. Crowd size and density at an event, from aboveCrowd too dense: people per square metre · person → zone → counter → alert+ 7 other fields
14. Cracks under bridges, loose facade tiles, blocked roof drainsStructure wearing out: cracks, corrosion, loose parts · custom detector + segment → trend → report+ 9 other fields
15. People cleared from under the flight path before take-offPerson inside a hazard zone while it is live · person → zone → schedule → alert + relay+ 14 other fields

9 solutions · 1 only here

Insurance & damage inspection

What was damaged, when, and was it damaged before?

Built fromcustom detectorclassifycomparesegmentmeasurevehicletrackerspeedruledrone videoOCR

Build this for my site

1. Dented panel or water-stained wall measured from claim photosDamage named and measured from claim photos · segment → classify → measure → report
2. Dashcam clip: speeds and positions before a crashSpeeds and positions before a crash, from the video · vehicle → tracker → speed → report+ 1 other field
3. Pre-policy photos checked for all eight anglesPhoto set checked: every angle, sharp, right background · classify → rule → review+ 1 other field
4. Claim photo already used in an earlier claimPhoto evidence reused, or taken in the wrong place · classify → compare → review+ 1 other field
5. Snags listed from a new flat’s handover videoSnags listed from a handover walk-through · custom detector → snapshot → report+ 1 other field
6. Repair done as quoted, checked from before and after photoscustom detector → compare → review+ 1 other field
7. Hail damage to roofs and crops, from a droneStorm and hail damage surveyed from the air · drone video → segment → measure → report+ 3 other fields
8. New scratches since pick-up, on a rental car walk-roundDamage at handover: new since the last check-in · custom detector → compare → snapshot → report+ 5 other fields
9. Odometer and VIN read from the claim photosUnit numbers read and logged: containers, wagons, VINs, serials · custom detector → OCR → webhook+ 8 other fields

18 solutions · 2 only here

Pools, beaches & water parks

Is every swimmer safe, and is a lifeguard watching?

Built fromzonepersonrulecustom detectortimerscheduleany-object (YOLOE)posepostspeedcountermotionsegmenttracker

Build this for my site

1. Diving into the shallow endDiving into water too shallow for it · pose → zone → rule → alert
2. Rip current opening off the beachmotion + segment → rule → alert
3. Lifeguard facing away from the waterOperator at the controls and watching when it matters · pose → post → rule → alert+ 2 other fields
4. Swimmer still underwater for 10 s, or thrashing in placeSomeone in trouble in the water · person → tracker → timer → alert+ 2 other fields
5. Someone in the water after the pool has closedSomeone in the water where or when it is banned · person → zone → schedule → alert+ 2 other fields
6. Slide rider sent before the last one cleared the exitNext rider sent before the way is clear · person + custom detector → zone → sequence → relay+ 2 other fields
7. Running on the wet pool deckRunning or racing where people must walk · person → speed → zone → alert+ 2 other fields
8. Shark or jellyfish swarm near the swimming areaSharks or jellyfish near swimmers or cages · drone video + custom detector → zone → alert+ 2 other fields
9. Main drain no longer visible: water turning cloudyWater turning cloudy, green or foamy · colour → trend → alert+ 3 other fields
10. Bottles and glasses on the pool deckThings brought where they are not allowed · any-object (YOLOE) → zone → alert+ 5 other fields
11. Lifebuoy missing from its postSafety kit or cover missing from its place · any-object (YOLOE) → rule → alert+ 5 other fields
12. Litter left on the beach at duskLitter on the ground, picked or not · custom detector → schedule → report+ 5 other fields
13. Jet ski within 30 m of swimmersNear miss between a person and a moving machine · person + any-object (YOLOE) → proximity → speed → alert+ 6 other fields
14. People per square metre on the beach at peakCrowd too dense: people per square metre · person → zone → counter → alert+ 7 other fields
15. How full the pool is, shown at the entranceHow full it is right now, against capacity · person → zone → counter → webhook+ 9 other fields
16. Lifeguard chair empty while swimmers are inPost manned: a work position empty too long · person → post → timer → alert+ 9 other fields
17. Deck chairs moved into the lifeguard’s line of sightSomething blocking a way or kit that must stay clear · tile → custom detector → zone → timer → alert+ 12 other fields
18. Swimmer under the diving board while someone is on itPerson inside a hazard zone while it is live · person → zone → schedule → alert + relay+ 14 other fields

18 solutions · 15 only here

Sports & coaching

How fast, how far and how well did each player move?

Built fromtrackerposecustom detectorpersoncounterlinespeedmeasuretimertilesensorclassifyrulesegment

Build this for my site

1. Player speed and distance covered per matchperson → tracker → speed → report
2. Offside line drawn at the moment of the passpose + tracker → line → review
3. Pass map: who passed to whom, and how oftenperson + custom detector → tracker → report
4. Shot speed on goal in km/hShot speed in km/h · custom detector → tracker → speed → report
5. Goalkeeper’s dive direction on penaltiespose → tracker → report
6. Referee’s distance from each foulperson → tracker → measure → report
7. Tennis ball in or out at the lineBall in or out at the line · tile → custom detector → line → review
8. Basketball shots taken and madeShots taken and made · custom detector + pose → counter → report
9. Sprint start reaction time from the gunpose + sensor → timer → report
10. Finish order from a photo-finish cameracustom detector → line → timer → report
11. Stroke rate and lap times for each swimmerpose → tracker → counter → report
12. Punches thrown and landed per roundpose → counter → report
13. Kurash throws scored from the mat cameraThrows scored from the mat camera · pose → classify → review
14. Steps taken after a gymnastics landingSteps taken after a landing · pose → counter → review
15. Ball possession per team, minute by minuteperson + custom detector → tracker → report
16. Goals, shots and big moments cut into clipsHighlights cut automatically: goals, shots, big moments · custom detector + tracker → rule → clip+ 1 other field
17. Training pitch worn in patchesPitch grass worn in patches · segment → trend → report+ 1 other field
18. Landings, swings and strides scored for techniqueMovement form scored: technique and injury risk · pose → measure → review+ 2 other fields

14 solutions · 2 only here

Gyms & fitness clubs

How full is the gym, and is every rep and every movement right?

Built fromposecounterpersonface IDzonemeasureturnstilereconcileruletimerany-object (YOLOE)postvehicleattendance

Build this for my site

1. Reps counted on squats, push-ups and pressesReps counted on every set · pose → counter → report
2. Jump height from the flight timepose → measure → report
3. Membership card lent to a friend, caught at the turnstileBadge used by someone other than its owner · turnstile + face ID → reconcile → report+ 2 other fields
4. Squat depth, rounded backs and overstriding, rep by repMovement form scored: technique and injury risk · pose → measure → review+ 2 other fields
5. Members let in by face at the turnstileDoors opened by face: no card to lose or lend · face ID → rule → relay+ 3 other fields
6. Machine held with a towel while nobody trainsBooked or reserved, and nobody there · any-object (YOLOE) → zone → timer → webhook+ 3 other fields
7. Heavy bench press or a climber with nobody spotting or belayingNobody alone where a second person is required · person → post + counter → rule → alert+ 4 other fields
8. Two people in on one membership swipeTwo people through on one badge or ticket · turnstile + person → reconcile → alert+ 4 other fields
9. Use of each machineHow much each room, bay or machine is really used · person + vehicle → zone → counter → report+ 6 other fields
10. Personal trainer’s session time with each clientHours on site by face: staff, contractors, trainers · face ID → attendance → report+ 6 other fields
11. Frayed cable on a weight machineWear parts worn out: teeth, tyres, cables, pads · custom detector → classify → report+ 6 other fields
12. Member collapsed on the gym floorFall or collapse: someone down and not getting up · pose → person down → alert + relay+ 7 other fields
13. Gym-floor occupancy by the hour, shown in the members’ appHow full it is right now, against capacity · person → zone → counter → webhook+ 9 other fields
14. Treadmill running with nobody on itEngines and equipment running when nobody needs them · motion + thermal camera → timer → alert+ 10 other fields

21 solutions · 3 only here

Theme parks & zoos

Is every rider secured, every animal accounted for, and every guest behind the line?

Built fromzonepersoncustom detectorruletimertrackerposecounterspeedclassifyvehiclesensorsequenceanimal

Build this for my site

1. Boat stuck in the flume, or go-karts bunched on the trackRide vehicles stuck or bunched on the track · custom detector → tracker → speed → alert
2. Keeper in a big-cat enclosure with the slide door openKeeper inside with a dangerous animal’s door open · face ID + classify → rule → alert
3. Car window opened in the safari park near the animalsCar window opened near the animals in a safari park · vehicle + classify → zone → alert
4. Lap bar closed on every seat before dispatchRestraint closed on every seat before it moves · custom detector → rule → relay+ 1 other field
5. Visitor reaching over the barrier to feed the animalsToo close to something protected, in metres · person → zone → alert+ 1 other field
6. Guests climbing over to jump the ride queueServed out of turn · sensor + person → sequence → review+ 1 other field
7. Eating time and pacing per animal in each enclosureTime budget per animal: lying, eating, pacing · animal → zone → timer → report+ 1 other field
8. Operator’s hands off the controls at dispatchOperator at the controls and watching when it matters · pose → post → rule → alert+ 2 other fields
9. Loose items left on the ride platform before dispatchNext rider sent before the way is clear · person + custom detector → zone → sequence → relay+ 2 other fields
10. Ride stopped with riders stuck at the topPeople trapped in a stopped lift or ride · person + sensor → zone → timer → alert+ 2 other fields
11. Every animal seen, and back in the night house at closingAnimal headcount: all present, and through each gate · animal + custom detector → line → counter → report+ 3 other fields
12. Crowd pushing over the barrier along the parade routeCrowd barrier pushed over, climbed or opened · person + custom detector → zone → rule → alert+ 4 other fields
13. Rider standing up while the ride movesClimbing, standing or sitting where it is not allowed · pose → zone → rule → alert+ 5 other fields
14. Guests suddenly running from one part of the parkCrowd suddenly running: many people fleeing at once · person → tracker → speed → alert+ 6 other fields
15. Crowd packing the plaza before the fireworksCrowd too dense: people per square metre · person → zone → counter → alert+ 7 other fields
16. Service vehicle driving down a crowded pathVehicles, carts or scooters in a space kept for people · any-object (YOLOE) → zone → schedule → alert+ 7 other fields
17. Bag lifted from a pushchair in the queueTheft from a person: pickpocket or bag snatch · pose + tracker → proximity → review+ 7 other fields
18. Ride down, and for how longMachine running, idle or stopped, minute by minute · motion + colour → zone → timer → report+ 10 other fields
19. Rides run empty at quiet hours: cycles against ridersEngines and equipment running when nobody needs them · motion + thermal camera → timer → alert+ 10 other fields
20. Guests on the parade route as the floats passPerson inside a hazard zone while it is live · person → zone → schedule → alert + relay+ 14 other fields
21. Ride queue time shown at the entranceQueue length and wait, with a call to open another point · person + vehicle → zone → counter + timer → alert+ 15 other fields

Show all 21

13 solutions

Ski resorts

Is everyone loaded safely, and is anyone skiing where it is closed?

Built frompersonzonecustom detectortimerruleclassifysensormeasuremotionvehiclecountertrendsequencespeed

Build this for my site

1. Chairlift safety bar left up after the stationRestraint closed on every seat before it moves · custom detector → rule → relay+ 1 other field
2. Gondola doors open while the cabin movesDoors open while the vehicle moves · classify + sensor → rule → alert+ 1 other field
3. Snow depth read off the snow stakeSnow depth and cover measured · custom detector → measure → trend → report+ 1 other field
4. Jumper sent before the landing zone is clearNext rider sent before the way is clear · person + custom detector → zone → sequence → relay+ 2 other fields
5. Chairlift stopped with skiers hanging on itPeople trapped in a stopped lift or ride · person + sensor → zone → timer → alert+ 2 other fields
6. Skiers above the speed limit on the beginners’ slopeRunning or racing where people must walk · person → speed → zone → alert+ 2 other fields
7. Avalanche or snow slide caught on the slope cameraRock, snow or mud sliding down a slope · motion → segment → alert+ 3 other fields
8. Whiteout on the upper slopesVisibility in fog or dust, measured from the camera · classify → measure → alert+ 5 other fields
9. Seats filled per chair on the busiest liftHow much each room, bay or machine is really used · person + vehicle → zone → counter → report+ 6 other fields
10. Skier fallen at the chairlift loading point, lift slowedFall or collapse: someone down and not getting up · pose → person down → alert + relay+ 7 other fields
11. Snow cannons running when it is too warm to make snowEngines and equipment running when nobody needs them · motion + thermal camera → timer → alert+ 10 other fields
12. Skiers on a closed run, or where a winch groomer worksPerson inside a hazard zone while it is live · person → zone → schedule → alert + relay+ 14 other fields
13. Wait at the lift base, shown on the piste mapQueue length and wait, with a call to open another point · person + vehicle → zone → counter + timer → alert+ 15 other fields

15 solutions

Elderly & care homes

Has anyone wandered off, and is every resident looked after?

Built fromposepersonzonetimercounterposturescheduleface IDCOCO objectspeedYOLO-Worldproximitymeasuresequence

Build this for my site

1. Resident getting up alone in the nightPatient getting out of bed alone · pose → posture → schedule → alert+ 1 other field
2. Bed-bound resident not turned for 2 hoursBed-bound patient not turned in time · pose → posture → timer → alert+ 1 other field
3. Resident in the bathroom for over 20 minToo long in the bathroom · person → zone → timer → alert+ 1 other field
4. Meals left uneaten and cups of water drunkMeals and drinks actually taken · pose + COCO object → counter → report+ 1 other field
5. Rough handling during a transfer, sent for reviewRough handling of a person in care · pose → speed → review+ 1 other field
6. Walking frame left out of reachWalking aid left out of reach · YOLO-World + person → proximity → alert+ 1 other field
7. Resident lifted by hand where a hoist should be usedAwkward lifting and bending, scored for strain · pose → measure → report+ 2 other fields
8. Someone going out of the garden gate at nightSomeone leaving the grounds when they should stay · person → zone → schedule → alert+ 2 other fields
9. Night checks and medicine rounds, room by roomRounds walked on time, checkpoint by checkpoint · face ID → zone → sequence → report+ 2 other fields
10. Carers on the floor against the residents up and aboutStaff on the floor against the customers in · face ID + person → counter → compare → report+ 4 other fields
11. Mould in a resident’s bathroomDamp and mould spreading on walls and ceilings · segment → trend → report+ 4 other fields
12. Residents stumbling in the same doorway, week by weekTrips and stumbles counted by place, before someone falls · pose → tracker → heatmap → report+ 6 other fields
13. Residents joining each activity sessionHow much each room, bay or machine is really used · person + vehicle → zone → counter → report+ 6 other fields
14. Resident fallen in a room, a corridor or the gardenFall or collapse: someone down and not getting up · pose → person down → alert + relay+ 7 other fields
15. Call bell unanswered for 5 minCall for help or an alarm, and how long until someone comes · person + sensor → zone → timer → alert+ 8 other fields

20 solutions

Data centres & server rooms

Who touched which rack, and was anyone in the hall who should not be?

Built fromzonetimerface IDpersonruledoor eventmotiontrendcustom detectorany-object (YOLOE)stream healthclassifyposeCOCO object

Build this for my site

1. Every rack face covered by a camera, checked dailyCamera down or a view uncovered, and since when · stream health → timer → alert+ 1 other field
2. Contractor in the hall without their escortVisitor inside without their escort · face ID + person → zone → rule → alert+ 1 other field
3. Mantrap with both doors openBoth doors of an airlock or mantrap open at once · door event → rule → alert+ 2 other fields
4. Hands inside a rack with no open ticketLocked cabinet opened, and by whom · classify + face ID → snapshot → report+ 2 other fields
5. Photos taken inside the data hallPhotos or filming where they are banned · pose + COCO object → zone → alert+ 2 other fields
6. Engineers let into the hall by faceDoors opened by face: no card to lose or lend · face ID → rule → relay+ 3 other fields
7. Someone in a hall nobody visits on SundaysSomething unusual for this camera at this hour · motion + tracker → trend → alert+ 3 other fields
8. Cables moved or blanking panels missing since the last auditChanged from its reference photo: 5S, cabling, layout · custom detector → compare → alert+ 3 other fields
9. Two people through the mantrap on one badgeTwo people through on one badge or ticket · turnstile + person → reconcile → alert+ 4 other fields
10. Visitor in another customer’s cageSomeone who isn’t staff in a staff-only area · face ID → post → alert+ 4 other fields
11. Vehicle forcing the site gateVehicle forcing its way through a barrier or gate · vehicle → speed → line → alert+ 5 other fields
12. Cardboard left in the data hallClutter left out: trays, trolleys, boxes, cables · any-object (YOLOE) → zone → timer → alert+ 5 other fields
13. Raised-floor tile left liftedSafety kit or cover missing from its place · any-object (YOLOE) → rule → alert+ 5 other fields
14. Hot spots on the rack fronts, from a thermal cameraHot spots on equipment from a thermal camera · thermal camera → heatmap → alert+ 5 other fields
15. Engineer’s time in each cage against their work ticketHours on site by face: staff, contractors, trainers · face ID → attendance → report+ 6 other fields
16. Rack or data-hall door left openDoor held open or forced · door event + person → timer → alert+ 7 other fields
17. Server or drive carried out of the hallValuable or equipment taken from its place · person + custom detector → zone → rule → alert+ 7 other fields
18. Water under the raised floor by a cooling unitLeak from a pipe, roof, tank or drum · segment → trend → alert+ 7 other fields
19. Engineer at the rack after an alarm, in minutesCall for help or an alarm, and how long until someone comes · person + sensor → zone → timer → alert+ 8 other fields
20. Red status light on a server frontMachine running, idle or stopped, minute by minute · motion + colour → zone → timer → report+ 10 other fields

Show all 20

14 solutions · 2 only here

Lifts & escalators

Is anyone stuck, hurt or at risk in a lift or on an escalator?

Built fromzonepersonposetimercountercustom detectormeasuremotionruleCOCO objectsensorany-object (YOLOE)trackerheatmap

Build this for my site

1. Lift car not level with the floor when the doors opencustom detector → measure → alert
2. Handrail running slower than the stepsmotion → measure → alert
3. Arm or pushchair caught in the lift doorsSomeone caught in closing doors · person + COCO object → zone → relay+ 1 other field
4. Passenger trapped in a stopped liftPeople trapped in a stopped lift or ride · person + sensor → zone → timer → alert+ 2 other fields
5. Mirror or buttons smashed in the liftVandalism caught as it happens · pose → zone → rule → alert+ 2 other fields
6. Someone sitting on the escalator handrailClimbing, standing or sitting where it is not allowed · pose → zone → rule → alert+ 5 other fields
7. Pushchairs on the escalator, goods in the passenger liftThings brought where they are not allowed · any-object (YOLOE) → zone → alert+ 5 other fields
8. Riders stumbling as they step off the escalatorTrips and stumbles counted by place, before someone falls · pose → tracker → heatmap → report+ 6 other fields
9. Broken teeth on the escalator comb plateWear parts worn out: teeth, tyres, cables, pads · custom detector → classify → report+ 6 other fields
10. Fall at the escalator comb, the escalator stoppedFall or collapse: someone down and not getting up · pose → person down → alert + relay+ 7 other fields
11. Crowd building at the foot of the escalatorCrowd too dense: people per square metre · person → zone → counter → alert+ 7 other fields
12. Lift car overcrowded before the doors closeHow full it is right now, against capacity · person → zone → counter → webhook+ 9 other fields
13. Escalator stopped, or a lift held at a floor for 2 minMachine running, idle or stopped, minute by minute · motion + colour → zone → timer → report+ 10 other fields
14. Lift waiting time in the lobby, by hourQueue length and wait, with a call to open another point · person + vehicle → zone → counter + timer → alert+ 15 other fields

13 solutions

Cleaning & facility services

Was every room cleaned when the contract says, and can you prove it?

Built fromzonecustom detectorrulepersonface IDsequencesegmentposeany-object (YOLOE)timerlinecountercolourclassify

Build this for my site

1. Toilet visits counted, cleaning called after every 50Cleaning called by use, not by the clock · person → line → counter → alert+ 1 other field
2. Cleaner’s visits to each toilet against the rotaRounds walked on time, checkpoint by checkpoint · face ID → zone → sequence → report+ 2 other fields
3. Colour-coded cloths and mops used in the right roomsColour-coded boards, cloths and tools used where they belong · colour + custom detector → rule → alert+ 2 other fields
4. Floors mopped to the corners, windows left without streaksCleaned properly: nothing missed, no streaks or spots · custom detector → classify → review+ 3 other fields
5. Wet floor with no warning sign outSpill or puddle where people walk · segment + YOLO-World → rule → alert+ 4 other fields
6. UV disinfection lamp cut when someone walks inMachine stopped when someone steps into its danger zone · person → zone → relay+ 5 other fields
7. Window cleaner leaning out from the top of a ladderLadder used unsafely: top step, over-reaching, unfooted · pose + custom detector → rule → alert+ 5 other fields
8. Cups and dishes piling up in the office kitchen sinkClutter left out: trays, trolleys, boxes, cables · any-object (YOLOE) → zone → timer → alert+ 5 other fields
9. Litter picked from the grounds before 8:00Litter on the ground, picked or not · custom detector → schedule → report+ 5 other fields
10. Cleaning chemicals left unattended on a trolleyObject left behind by its owner · any-object (YOLOE) → timer → cross-camera → alert+ 6 other fields
11. Contract cleaners’ hours on site against the invoiceHours on site by face: staff, contractors, trainers · face ID → attendance → report+ 6 other fields
12. Office bins full before the evening roundBin, tank or bag nearly full or nearly empty · segment → measure → alert+ 9 other fields
13. Every surface wiped in order when a ward room is cleanedSteps of a procedure done, and in the right order · pose → zone → sequence → alert+ 11 other fields

13 solutions

Toll roads & plazas

Did every vehicle pay the right toll, and is every lane moving?

Built fromvehicleplate OCRcomparetrackersensorpersonruleclassifycounterzoneposehands raiseddirectionspeed

Build this for my site

1. Plate covered or unreadable as it passesPlate covered, dirty or missing · plate OCR → rule → snapshot+ 1 other field
2. Cars swerving across lanes at the plazaLane or turn rule broken: solid line, U-turn, bus lane · vehicle → tracker → zone → snapshot+ 1 other field
3. Overloaded truck on the weigh-in-motion strip, photographedOverloaded truck photographed on the scales · sensor + vehicle → plate OCR → snapshot+ 1 other field
4. Ambulances and fire engines let through without stoppingEmergency vehicles let through without stopping · vehicle → classify → relay+ 1 other field
5. Barrier arm struck by a vehicle, plate keptDamage caused by a vehicle, with its plate · vehicle → tracker → plate OCR → snapshot+ 1 other field
6. Car-pool discount checked by counting who is in the carOccupants counted for the car-pool lane · vehicle + person → counter → rule → snapshot+ 1 other field
7. Tailgating through the barrier, or no tag in a tag-only laneVehicle leaving without paying · plate OCR + sensor → compare → alert+ 2 other fields
8. Toll collector held up in the boothDuress: hands raised in a hold-up · pose → hands raised → alert+ 3 other fields
9. Vehicle reversing out of a toll laneGoing the wrong way through a one-way point · vehicle + person → direction → alert+ 3 other fields
10. Plaza queues and lane speeds, lane by laneCongestion building: speeds dropping, queues growing · vehicle → tracker → speed → alert+ 4 other fields
11. Toll dodgers on cloned plates, caught by make and colourPlate that does not match the car: cloned or swapped · plate OCR + classify + colour → compare → alert+ 5 other fields
12. Vehicles and axle classes per lane against the tolls paidHeadcount against tickets and transactions · person + vehicle + sensor → counter → compare → review+ 7 other fields
13. Tanker hazard placard read and checkedLabel and code present, straight and right · OCR + barcode → compare → relay+ 11 other fields

13 solutions

EV charging

Is every charger working, and is the car in front of it actually charging?

Built fromcustom detectorvehiclecomparezonetimercounterruleplate OCRpersonOCRlineany-object (YOLOE)sensorclassify

Build this for my site

1. Car pulling away with the charging cable still plugged inCar driving off still connected to the pump or charger · custom detector + vehicle → rule → alert+ 1 other field
2. Error message on the charger screen, read and reportedSelf-service machine showing an error · OCR → rule → webhook+ 1 other field
3. Skimmer fitted to a charger’s card readerSkimmer fitted to a card reader · custom detector → compare → alert+ 2 other fields
4. Car in a charging bay with no cable plugged inParking bay misused: across two, or no right to it · vehicle + plate OCR → zone → compare → alert+ 2 other fields
5. Taxi fleet: each car’s charging time per shift, by plateEach vehicle’s time out and back, by plate · plate OCR → line → timer → report+ 2 other fields
6. Batteries counted in and out of a swap stationReturnable cages, crates and batteries counted out and back · custom detector → counter → compare → report+ 2 other fields
7. Charging cable dropped across the bayClutter left out: trays, trolleys, boxes, cables · any-object (YOLOE) → zone → timer → alert+ 5 other fields
8. Charging sessions per bay against the charger’s logHeadcount against tickets and transactions · person + vehicle + sensor → counter → compare → review+ 7 other fields
9. Car hogging a charging bay past its time limitVehicle stopped too long where time is limited · vehicle → zone → timer → alert+ 8 other fields
10. Charger vandalised: screen cracked or connector goneBroken fittings found: glass, seats, nets, racking · custom detector → compare → report+ 8 other fields
11. Charger status light dark or redLights, screens and signs dark when they should be on · classify → schedule → report+ 9 other fields
12. Smoke or heat building on a charging carFlame or smoke spotted early, indoors or on the horizon · custom detector + thermal camera → PTZ → alert+ 12 other fields
13. Cars queuing for a free chargerQueue length and wait, with a call to open another point · person + vehicle → zone → counter + timer → alert+ 15 other fields

15 solutions

Telecom towers

Is every tower site intact, powered and visited only by the right crew?

Built fromcustom detectorpersonzonerulecomparemotiontrendmeasuredrone videoany-object (YOLOE)barcodesensortrackerface ID

Build this for my site

1. Nests built on the antennasBird nests on pylons and masts · drone video → custom detector → report+ 1 other field
2. Crane lifting at a tower with its outriggers not outMobile crane lifting without its outriggers out on mats · custom detector → rule → alert+ 2 other fields
3. Diesel siphoned from the generator at a tower siteFuel siphoned from a tank or generator · person + any-object (YOLOE) → zone → alert+ 2 other fields
4. Diesel delivery filmed and matched to the litres billedJob or delivery filmed and tied to its order · barcode + sensor → clip → compare → review+ 2 other fields
5. Crew in a fibre trench with the walls unsupportedTrench unsafe: no shoring, spoil at the edge, someone inside · person + custom detector → zone → rule → alert+ 3 other fields
6. A visit to a tower site on no scheduleSomething unusual for this camera at this hour · motion + tracker → trend → alert+ 3 other fields
7. Antenna knocked out of alignment after a stormKnocked out of line: antennas, trackers, tank roofs · custom detector → measure → compare → alert+ 3 other fields
8. Ice load on the antennas after freezing rainIce or snow building up where it can fall or overload · custom detector → measure → alert+ 3 other fields
9. Crew’s visit matched to the work order: arrival and time on siteHours on site by face: staff, contractors, trainers · face ID → attendance → report+ 6 other fields
10. Cables or batteries carried off site at nightValuable or equipment taken from its place · person + custom detector → zone → rule → alert+ 7 other fields
11. Aviation warning lights out on the mastLights, screens and signs dark when they should be on · classify → schedule → report+ 9 other fields
12. Mast leaning or a guy wire gone slackStructure wearing out: cracks, corrosion, loose parts · custom detector + segment → trend → report+ 9 other fields
13. Generator running while the mains are onEngines and equipment running when nobody needs them · motion + thermal camera → timer → alert+ 10 other fields
14. Anyone inside the compound of an unstaffed towerIntrusion: someone inside the fence or a closed zone · person → zone → PTZ → alert+ 14 other fields
15. Harness on and clipped in on the mastProtective kit worn where the job needs it · person + custom detector → zone → alert+ 20 other fields